test_SProt testing sp001... *Using SequenceParser Q13454 N33_HUMAN N33 PROTEIN. Seq('MGARGAPSRRRQAGRRLRYLPTGSFPFLLLLLLLCIQLGGGQKKKENLLAEKVEQLMEWS ...', ProteinAlphabet()) *Using RecordParser N33_HUMAN ['Q13454', 'Q14911', 'Q14912'] ['Eukaryota', 'Metazoa', 'Chordata', 'Craniata', 'Vertebrata', 'Mammalia', 'Eutheria', 'Primates', 'Catarrhini', 'Hominidae', 'Homo'] (348, 39676, '75818910') ***Features: ('TRANSMEM', 20, 40, 'POTENTIAL.', '') ('TRANSMEM', 197, 217, 'POTENTIAL.', '') ('TRANSMEM', 222, 242, 'POTENTIAL.', '') ('TRANSMEM', 277, 297, 'POTENTIAL.', '') ('TRANSMEM', 313, 333, 'POTENTIAL.', '') ('VARSPLIC', 344, 348, 'DLDFE -> FLIK (IN FORM 2).', '') ***References: authors: MACGROGAN D., LEVY A., BOVA G.S., ISAACS W.B., BOOKSTEIN R.; title: "Structure and methylation-associated silencing of a gene within a homozygously deleted region of human chromosome band 8p22."; references: [('MEDLINE', '96299740')] testing sp002... *Using SequenceParser P54101 CSP_MOUSE CYSTEINE STRING PROTEIN (CSP). Seq('MADQRQRSLSTSGESLYHVLGLDKNATSDDIKKSYRKLALKYHPDKNPDNPEAADKFKEI ...', ProteinAlphabet()) *Using RecordParser CSP_MOUSE ['P54101'] ['Eukaryota', 'Metazoa', 'Chordata', 'Craniata', 'Vertebrata', 'Mammalia', 'Eutheria', 'Rodentia', 'Sciurognathi', 'Muridae', 'Murinae', 'Mus'] (198, 22100, '9DF0142B') ***Features: ('DOMAIN', 13, 82, 'DNAJ-LIKE.', '') ('DOMAIN', 118, 128, 'POLY-CYS.', '') ***References: authors: QIN N., LIN T., BIRNBAUMER L.; title: references: [] authors: MASTROGIACOMO A., GUNDERSEN C.B.; title: "The nucleotide and deduced amino acid sequence of a rat cysteine string protein."; references: [('MEDLINE', '95223109')] authors: BRAUN J.E., SCHELLER R.H.; title: "Cysteine string protein, a DnaJ family member, is present on diverse secretory vesicles."; references: [('MEDLINE', '96188189')] testing sp003... *Using SequenceParser P42655 143E_HUMAN 14-3-3 PROTEIN EPSILON (MITOCHONDRIAL IMPORT STIMULATION FACTOR L SUBUNIT) (PROTEIN KINASE C INHIBITOR PROTEIN-1) (KCIP-1) (14-3-3E). Seq('MDDREDLVYQAKLAEQAERYDEMVESMKKVAGMDVELTVEERNLLSVAYKNVIGARRASW ...', ProteinAlphabet()) *Using RecordParser 143E_HUMAN ['P42655', 'P29360', 'Q63631'] ['EUKARYOTA', 'METAZOA', 'CHORDATA', 'VERTEBRATA', 'MAMMALIA', 'EUTHERIA', 'PRIMATES', 'CATARRHINI', 'HOMINIDAE', 'HOMO'] (255, 29174, '40A43E62') ***Features: ('MOD_RES', 1, 1, 'ACETYLATION.', '') ('CONFLICT', 73, 73, 'K -> T (IN REF. 8).', '') ('CONFLICT', 120, 120, 'F -> S (IN REF. 8).', '') ('CONFLICT', 123, 123, 'K -> Y (IN REF. 8).', '') ('CONFLICT', 129, 129, 'H -> Y (IN REF. 13).', '') ***References: authors: CONKLIN D.S., GALAKTIONOV K., BEACH D.; title: "14-3-3 proteins associate with cdc25 phosphatases."; references: [('MEDLINE', '95372385')] authors: LUK S.C.W., LEE C.Y., WAYE M.M.Y.; title: references: [] authors: JIN D.Y., LYU M.S., KOZAK C.A., JEANG K.T.; title: "Function of 14-3-3 proteins."; references: [('MEDLINE', '96300316')] authors: CHONG S.S., TANIGAMI A., ROSCHKE A.V., LEDBETTER D.H.; title: "14-3-3 epsilon has no homology to LIS1 and lies telomeric to it on chromosome 17p13.3 outside the Miller-Dieker syndrome chromosome region."; references: [('MEDLINE', '97011338')] authors: TANIGAMI A., CHONG S.S., LEDBETTER D.H.; title: "14-3-3 epsilon genomic sequence."; references: [] authors: ROSEBOOM P.H., WELLER J.L., BABILA T., AITKEN A., SELLERS L.A., MOFFET J.R., NAMBOODIRI M.A., KLEIN D.C.; title: "Cloning and characterization of the epsilon and zeta isoforms of the 14-3-3 proteins."; references: [('MEDLINE', '94296566')] authors: ALAM R., HACHIYA N., SAKAGUCHI M., SHUN-ICHIRO K., IWANAGA S., KITAJIMA M., MIHARA K., OMURA T.; title: "cDNA cloning and characterization of mitochondrial import stimulation factor (MSF) purified from rat liver cytosol."; references: [('MEDLINE', '95122474')] authors: GAO L., GU X.B., YU D.S., YU R.K., ZENG G.; title: "Association of a 14-3-3 protein with CMP-NeuAc:GM1 alpha 2,3- sialyltransferase."; references: [('MEDLINE', '96280718')] authors: MCCONNELL J.E., ARMSTRONG J.F., BARD J.B.; title: "The mouse 14-3-3 epsilon isoform, a kinase regulator whose expression pattern is modulated in mesenchyme and neuronal differentiation."; references: [('MEDLINE', '95269876')] authors: TAKIHARA Y., IRIE K., NOMURA M., MOTALEB M., MATSUMOTO K., SHIMADA K.; title: references: [] authors: JONES J.M., NIIKURA T., PINKE R.M., GUO W., MOLDAY L., LEYKAM J., MCCONNELL D.G.; title: "Expression of 14-3-3 proteins in bovine retinal photoreceptors."; references: [] authors: TOKER A., SELLERS L.A., AMESS B., PATEL Y., HARRIS A., AITKEN A.; title: "Multiple isoforms of a protein kinase C inhibitor (KCIP-1/14-3-3) from sheep brain. Amino acid sequence of phosphorylated forms."; references: [('MEDLINE', '92283271')] authors: TOKER A., ELLIS C.A., SELLERS L.A., AITKEN A.; title: "Protein kinase C inhibitor proteins. Purification from sheep brain and sequence similarity to lipocortins and 14-3-3 protein."; references: [('MEDLINE', '90345949')] testing sp004... *Using SequenceParser P23082 NDOA_PSEPU NAPHTHALENE 1,2-DIOXYGENASE SYSTEM FERREDOXIN COMPONENT. Seq('TVKWIEAVALSDILEGDVLGVTVEGKELALYEVEGEIYATDNLCTHGSARMSDGYLEGRE ...', ProteinAlphabet()) *Using RecordParser NDOA_PSEPU ['P23082', 'Q52123', 'O07829'] ['Bacteria', 'Proteobacteria', 'gamma subdivision', 'Pseudomonas group', 'Pseudomonas'] (103, 11315, '9F91B3C8') ***Features: ('INIT_MET', 0, 0, '', '') ('METAL', 44, 44, 'IRON-SULFUR (2FE-2S) (POTENTIAL).', '') ('METAL', 46, 46, 'IRON-SULFUR (2FE-2S) (POTENTIAL).', '') ('METAL', 63, 63, 'IRON-SULFUR (2FE-2S) (POTENTIAL).', '') ('METAL', 66, 66, 'IRON-SULFUR (2FE-2S) (POTENTIAL).', '') ('VARIANT', 2, 2, 'V -> E (IN STRAIN G7).', '') ('VARIANT', 14, 14, 'L -> P (IN STRAIN G7).', '') ('VARIANT', 48, 48, 'S -> A (IN STRAIN G7).', '') ('VARIANT', 76, 76, 'K -> R (IN STRAIN G7).', '') ('VARIANT', 84, 84, 'Q -> E (IN STRAIN G7).', '') ('VARIANT', 90, 90, 'P -> A (IN STRAIN G7).', '') ('VARIANT', 103, 103, 'S -> GEF (IN STRAIN G7).', '') ***References: authors: KURKELA S., LEHVAESLAIHO H., PALVA E.T., TEERI T.H.; title: "Cloning, nucleotide sequence and characterization of genes encoding naphthalene dioxygenase of Pseudomonas putida strain NCIB9816."; references: [('MEDLINE', '89211973')] authors: SIMON M.J., OSSLUND T.D., SAUNDERS R., ENSLEY B.D., SUGGS S., HARCOURT A.A., SUEN W.-C., CRUDEN D.L., GIBSON D.T., ZYLSTRA G.J.; title: "Sequences of genes encoding naphthalene dioxygenase in Pseudomonas putida strains G7 and NCIB 9816-4."; references: [('MEDLINE', '93252277')] authors: DENOME S.A., STANLEY D.C., OLSON E.S., YOUNG K.D.; title: "Metabolism of dibenzothiophene and naphthalene in Pseudomonas strains: complete DNA sequence of an upper naphthalene catabolic pathway."; references: [('MEDLINE', '94042852')] authors: HAMANN C.; title: references: [] testing sp005... *Using SequenceParser P24973 NU3M_BALPH NADH-UBIQUINONE OXIDOREDUCTASE CHAIN 3 (EC 1.6.5.3). Seq('MNLLLTLLTNTTLALLLVFIAFWLPQLNVYAEKTSPYECGFDPMGSARLPFSMKFFLVAI ...', ProteinAlphabet()) *Using RecordParser NU3M_BALPH ['P24973'] ['Eukaryota', 'Metazoa', 'Chordata', 'Craniata', 'Vertebrata', 'Mammalia', 'Eutheria', 'Cetartiodactyla', 'Cetacea', 'Mysticeti', 'Balaenopteridae', 'Balaenoptera'] (115, 13022, 'ACF02965') ***Features: ***References: authors: ARNASON U., GULLBERG A., WIDEGREN B.; title: "The complete nucleotide sequence of the mitochondrial DNA of the fin whale, Balaenoptera physalus."; references: [('MEDLINE', '92139449')] authors: ARNASON U., GULLBERG A.; title: "Comparison between the complete mtDNA sequences of the blue and the fin whale, two species that can hybridize in nature."; references: [('MEDLINE', '94141932')] testing sp006... *Using SequenceParser P39896 TCMO_STRGA TETRACENOMYCIN POLYKETIDE SYNTHESIS 8-O-METHYL TRANSFERASE TCMO (EC 2.1.1.-). Seq('MTPHTHVRGPGDILQLTMAFYGSRALISAVELDLFTLLAGKPLPLGELCERAGIHPRGAR ...', ProteinAlphabet()) *Using RecordParser TCMO_STRGA ['P39896'] ['BACTERIA', 'FIRMICUTES', 'ACTINOBACTERIA', 'ACTINOBACTERIDAE', 'ACTINOMYCETALES', 'STREPTOMYCINEAE', 'STREPTOMYCETACEAE', 'STREPTOMYCES'] (339, 37035, '848B7337') ***Features: ***References: authors: SUMMERS R.G., WENDT-PIENKOWSKI E., MOTAMEDI H., HUTCHINSON C.R.; title: "Nucleotide sequence of the tcmII-tcmIV region of the tetracenomycin C biosynthetic gene cluster of Streptomyces glaucescens and evidence that the tcmN gene encodes a multifunctional cyclase-dehydratase-O-methyl transferase."; references: [('MEDLINE', '92193265')] testing sp007... *Using SequenceParser O95832 CLD1_HUMAN CLAUDIN-1 (SENESCENCE-ASSOCIATED EPITHELIAL MEMBRANE PROTEIN). Seq('MANAGLQLLGFILAFLGWIGAIVSTALPQWRIYSYAGDNIVTAQAMYEGLWMSCVSQSTG ...', ProteinAlphabet()) *Using RecordParser CLD1_HUMAN ['O95832'] ['Eukaryota', 'Metazoa', 'Chordata', 'Craniata', 'Vertebrata', 'Mammalia', 'Eutheria', 'Primates', 'Catarrhini', 'Hominidae', 'Homo'] (211, 22744, '07269000E6C214F0') ***Features: ('TRANSMEM', 8, 28, 'POTENTIAL.', '') ('TRANSMEM', 82, 102, 'POTENTIAL.', '') ('TRANSMEM', 116, 136, 'POTENTIAL.', '') ('TRANSMEM', 164, 184, 'POTENTIAL.', '') ('CONFLICT', 62, 62, 'I -> V (IN REF. 2).', '') ('CONFLICT', 135, 135, 'V -> A (IN REF. 2).', '') ***References: authors: Swisshelm K.L., Machl A., Planitzer S., Robertson R., Kubbies M., Hosier S.; title: "SEMP1, a senescence-associated cDNA isolated from human mammary epithelial cells, is a member of an epithelial membrane protein superfamily."; references: [('MEDLINE', '99132301')] authors: Mitic L.M., Anderson J.M.; title: "Human claudin-1 isolated from Caco-2 mRNA."; references: [] testing sp008... *Using SequenceParser Q95352 1A02_HUMAN HLA CLASS I HISTOCOMPATIBILITY ANTIGEN, A-2 ALPHA CHAIN PRECURSOR. Seq('MAVMAPRTLVLLLSGALALTQTWAGSHSMRYFFTSVSRPGRGEPRFIAVGYVDDTQFVRF ...', ProteinAlphabet()) *Using RecordParser 1A02_HUMAN ['P01892', 'P06338', 'P30514', 'P30444', 'P30445', 'P30446', 'Q29680', 'Q29899', 'Q95352', 'Q29837', 'Q95380'] ['Eukaryota', 'Metazoa', 'Chordata', 'Craniata', 'Vertebrata', 'Mammalia', 'Eutheria', 'Primates', 'Catarrhini', 'Hominidae', 'Homo'] (365, 40922, 'B54A97B24B337C08') ***Features: ('SIGNAL', 1, 24, '', '') ('CHAIN', 25, 365, 'HLA CLASS I HISTOCOMPATIBILITY ANTIGEN, A-2 ALPHA CHAIN.', '') ('DOMAIN', 25, 114, 'EXTRACELLULAR ALPHA-1.', '') ('DOMAIN', 115, 206, 'EXTRACELLULAR ALPHA-2.', '') ('DOMAIN', 207, 298, 'EXTRACELLULAR ALPHA-3.', '') ('DOMAIN', 299, 308, 'CONNECTING PEPTIDE.', '') ('TRANSMEM', 309, 332, '', '') ('DOMAIN', 333, 365, 'CYTOPLASMIC TAIL.', '') ('CARBOHYD', 110, 110, '', '') ('DISULFID', 125, 188, '', '') ('DISULFID', 227, 283, '', '') ('STRAND', 27, 36, '', '') ('STRAND', 45, 52, '', '') ('TURN', 53, 54, '', '') ('STRAND', 55, 61, '', '') ('TURN', 62, 63, '', '') ('STRAND', 70, 71, '', '') ('HELIX', 74, 76, '', '') ('TURN', 77, 78, '', '') ('HELIX', 81, 108, '', '') ('TURN', 109, 110, '', '') ('TURN', 113, 114, '', '') ('STRAND', 118, 127, '', '') ('TURN', 129, 130, '', '') ('STRAND', 133, 142, '', '') ('TURN', 143, 144, '', '') ('STRAND', 145, 150, '', '') ('TURN', 152, 153, '', '') ('STRAND', 157, 159, '', '') ('TURN', 163, 163, '', '') ('HELIX', 164, 173, '', '') ('TURN', 174, 175, '', '') ('HELIX', 176, 185, '', '') ('TURN', 186, 186, '', '') ('HELIX', 187, 198, '', '') ('TURN', 199, 199, '', '') ('HELIX', 200, 203, '', '') ('TURN', 204, 204, '', '') ('STRAND', 207, 207, '', '') ('STRAND', 210, 219, '', '') ('TURN', 220, 221, '', '') ('STRAND', 222, 233, '', '') ('STRAND', 238, 243, '', '') ('TURN', 244, 245, '', '') ('STRAND', 246, 247, '', '') ('HELIX', 249, 251, '', '') ('STRAND', 253, 254, '', '') ('STRAND', 258, 259, '', '') ('STRAND', 265, 274, '', '') ('TURN', 275, 276, '', '') ('HELIX', 278, 280, '', '') ('STRAND', 281, 286, '', '') ('TURN', 288, 289, '', '') ('STRAND', 294, 297, '', '') ('VARIANT', 33, 33, 'F -> Y (IN A*0205, A*0206, A*0208, A*0210 AND A*0221). /FTId=VAR_004334.', 'VAR_004334') ('VARIANT', 54, 54, 'D -> N (IN A*0221). /FTId=VAR_004335.', 'VAR_004335') ('VARIANT', 67, 67, 'Q -> R (IN A*0202, A*0205, AND A*0208). /FTId=VAR_004336.', 'VAR_004336') ('VARIANT', 90, 90, 'K -> N (IN A*0208 AND A*0220). /FTId=VAR_004337.', 'VAR_004337') ('VARIANT', 97, 98, 'TH -> ID (IN A*0211). /FTId=VAR_004338.', 'VAR_004338') ('VARIANT', 119, 119, 'V -> L (IN A*0202, A*0205, A*0208 AND A*0217). /FTId=VAR_004339.', 'VAR_004339') ('VARIANT', 121, 121, 'R -> M (IN A*0204 AND A*0217). /FTId=VAR_004340.', 'VAR_004340') ('VARIANT', 123, 123, 'Y -> C (IN A*0207 AND A*0218). /FTId=VAR_004341.', 'VAR_004341') ('VARIANT', 123, 123, 'Y -> F (IN A*0210 AND A*0217). /FTId=VAR_004342.', 'VAR_004342') ('VARIANT', 131, 131, 'W -> G (IN A*0210). /FTId=VAR_004343.', 'VAR_004343') ('VARIANT', 162, 162, 'M -> K (IN A*0218). /FTId=VAR_004344.', 'VAR_004344') ('VARIANT', 173, 173, 'A -> T (IN A*0203). /FTId=VAR_004345.', 'VAR_004345') ('VARIANT', 176, 176, 'V -> E (IN A*0203 AND A*0213). /FTId=VAR_004346.', 'VAR_004346') ('VARIANT', 180, 180, 'L -> W (IN A*0202, A*0203, A*0205 AND A*0208). /FTId=VAR_004347.', 'VAR_004347') ('VARIANT', 180, 180, 'L -> Q (IN A*0212 AND A*0213). /FTId=VAR_004348.', 'VAR_004348') ('VARIANT', 187, 187, 'T -> E (IN A*0216). /FTId=VAR_004349.', 'VAR_004349') ('VARIANT', 260, 260, 'A -> E (IN A*0209). /FTId=VAR_004350.', 'VAR_004350') ***References: authors: Koller B.H., Orr H.T.; title: "Cloning and complete sequence of an HLA-A2 gene: analysis of two HLA-A alleles at the nucleotide level."; references: [('MEDLINE', '85132727')] authors: Cianetti L., Testa U., Scotto L., la Valle R., Simeone A., Boccoli G., Giannella G., Peschle C., Boncinelli E.; title: "Three new class I HLA alleles: structure of mRNAs and alternative mechanisms of processing."; references: [('MEDLINE', '89122144')] authors: Ennis P.D., Zemmour J., Salter R.D., Parham P.; title: "Rapid cloning of HLA-A,B cDNA by using the polymerase chain reaction: frequency and nature of errors produced in amplification."; references: [('MEDLINE', '90207291')] authors: Belich M.P., Madrigal J.A., Hildebrand W.H., Zemmour J., Williams R.C., Luz R., Petzl-Erler M.L., Parham P.; title: "Unusual HLA-B alleles in two tribes of Brazilian Indians."; references: [('MEDLINE', '92269955')] authors: Krangel M.S.; title: "Unusual RNA splicing generates a secreted form of HLA-A2 in a mutagenized B lymphoblastoid cell line."; references: [('MEDLINE', '85230571')] authors: Orr H.T., Lopez de Castro J.A., Parham P., Ploegh H.L., Strominger J.L.; title: "Comparison of amino acid sequences of two human histocompatibility antigens, HLA-A2 and HLA-B7: location of putative alloantigenic sites."; references: [('MEDLINE', '80056745')] authors: Lopez de Castro J.A., Strominger J.L., Strong D.M., Orr H.T.; title: "Structure of crossreactive human histocompatibility antigens HLA-A28 and HLA-A2: possible implications for the generation of HLA polymorphism."; references: [('MEDLINE', '82247941')] authors: Mattson D.H., Handy D.E., Bradley D.A., Coligan J.E., Cowan E.P., Biddison W.E.; title: "DNA sequences of the genes that encode the CTL-defined HLA-A2 variants M7 and DK1."; references: [('MEDLINE', '87306734')] authors: Holmes N., Ennis P., Wan A.M., Denney D.W., Parham P.; title: "Multiple genetic mechanisms have contributed to the generation of the HLA-A2/A28 family of class I MHC molecules."; references: [('MEDLINE', '87252273')] authors: Domena J.D.; title: references: [] authors: Castano A.R., Lopez de Castro J.A.; title: "Structure of the HLA-A*0204 antigen, found in South American Indians. Spatial clustering of HLA-A2 subtype polymorphism."; references: [('MEDLINE', '92039809')] authors: Watkins D.I., McAdam S.N., Liu X., Stang C.R., Milford E.L., Levine C.G., Garber T.L., Dogon A.L., Lord C.I., Ghim S.H., Troup G.M., Hughes A.L., Letvin N.L.; title: "New recombinant HLA-B alleles in a tribe of South American Amerindians indicate rapid evolution of MHC class I loci."; references: [('MEDLINE', '92269956')] authors: Parham P., Lawlor D.A., Lomen C.E., Ennis P.D.; title: "Diversity and diversification of HLA-A,B,C alleles."; references: [('MEDLINE', '89235215')] authors: Ezquerra A., Domenech N., van der Poel J., Strominger J.L., Vega M.A., Lopez de Castro J.A.; title: "Molecular analysis of an HLA-A2 functional variant CLA defined by cytolytic T lymphocytes."; references: [('MEDLINE', '86305811')] authors: Domenech N., Ezquerra A., Castano R., Lopez de Castro J.A.; title: "Structural analysis of HLA-A2.4 functional variant KNE. Implications for the mapping of HLA-A2-specific T-cell epitopes."; references: [('MEDLINE', '88113844')] authors: Domenech N., Castano R., Goulmy E., Lopez de Castro J.A.; title: "Molecular analysis of HLA-A2.4 functional variant KLO: close structural and evolutionary relatedness to the HLA-A2.2 subtype."; references: [('MEDLINE', '88314183')] authors: Castano R., Ezquerra A., Domenech N., Lopez de Castro J.A.; title: "An HLA-A2 population variant with structural polymorphism in the alpha 3 region."; references: [('MEDLINE', '88186100')] authors: Epstein H., Kennedy L., Holmes N.; title: "An Oriental HLA-A2 subtype is closely related to a subset of Caucasoid HLA-A2 alleles."; references: [('MEDLINE', '89122133')] authors: Castano A.R., Lopez de Castro J.A.; title: "Structure of the HLA-A*0211 (A2.5) subtype: further evidence for selection-driven diversification of HLA-A2 antigens."; references: [('MEDLINE', '92218010')] authors: Barber D.F., Fernandez J.M., Lopez de Castro J.A.; title: "Primary structure of a new HLA-A2 subtype: HLA-A*0213."; references: [('MEDLINE', '94222455')] authors: Barouch D., Krausa P., Bodmer J., Browning M.J., McMichael A.J.; title: "Identification of a novel HLA-A2 subtype, HLA-A*0216."; references: [('MEDLINE', '95278976')] authors: Selvakumar A., Granja C.B., Salazar M., Alosco S.M., Yunis E.J., Dupont B.; title: "A novel subtype of A2 (A*0217) isolated from the South American Indian B-cell line AMALA."; references: [('MEDLINE', '95381236')] authors: Kashiwase K., Tokunaga K., Ishikawa Y., Oohashi H., Hashimoto M., Akaza T., Tadokoro K., Juji T.; title: "A new A2 sequence HLA-A2K from Japanese."; references: [] authors: Fleischhauer K., Zino E., Mazzi B., Severini G.M., Benazzi E., Bordignon C.; title: "HLA-A*02 subtype distribution in Caucasians from northern Italy: identification of A*0220."; references: [('MEDLINE', '97161038')] authors: Szmania S., Baxter-Lowe L.A.; title: "Nucleotide sequence of a novel HLA-A2 gene."; references: [] authors: Bjorkman P.J., Saper M.A., Samraoui B., Bennett W.S., Strominger J.L., Wiley D.C.; title: "Structure of the human class I histocompatibility antigen, HLA-A2."; references: [('MEDLINE', '88014204')] authors: Saper M.A., Bjorkman P.J., Wiley D.C.; title: "Refined structure of the human histocompatibility antigen HLA-A2 at 2.6-A resolution."; references: [('MEDLINE', '91245570')] testing sp009... *Using SequenceParser O23729 CHS3_BROFI CHALCONE SYNTHASE 3 (EC 2.3.1.74) (NARINGENIN-CHALCONE SYNTHASE 3). Seq('MAPAMEEIRQAQRAEGPAAVLAIGTSTPPNALYQADYPDYYFRITKSEHLTELKEKFKRM ...', ProteinAlphabet()) *Using RecordParser CHS3_BROFI ['O23729'] ['Eukaryota', 'Viridiplantae', 'Embryophyta', 'Tracheophyta', 'Spermatophyta', 'Magnoliophyta', 'Liliopsida', 'Asparagales', 'Orchidaceae', 'Bromheadia'] (394, 42941, '2F8D14AF4870BBB2') ***Features: ('ACT_SITE', 165, 165, 'BY SIMILARITY.', '') ***References: authors: Liew C.F., Lim S.H., Loh C.S., Goh C.J.; title: "Molecular cloning and sequence analysis of chalcone synthase cDNAs of Bromheadia finlaysoniana."; references: [] testing sp010... *Using SequenceParser Q13639 5H4_HUMAN 5-HYDROXYTRYPTAMINE 4 RECEPTOR (5-HT-4) (SEROTONIN RECEPTOR) (5-HT4). Seq('MDKLDANVSSEEGFGSVEKVVLLTFLSTVILMAILGNLLVMVAVCWDRQLRKIKTNYFIV ...', ProteinAlphabet()) *Using RecordParser 5H4_HUMAN ['Q13639', 'Q9UBM6', 'Q9UQR6', 'Q9UE22', 'Q9UE23', 'Q9UBT4', 'Q9NY73'] ['Eukaryota', 'Metazoa', 'Chordata', 'Craniata', 'Vertebrata', 'Euteleostomi', 'Mammalia', 'Eutheria', 'Primates', 'Catarrhini', 'Hominidae', 'Homo'] (388, 43761, '7FCFEC60E7BDF560') ***Features: ('DOMAIN', 1, 19, 'EXTRACELLULAR (POTENTIAL).', '') ('TRANSMEM', 20, 40, '1 (POTENTIAL).', '') ('DOMAIN', 41, 58, 'CYTOPLASMIC (POTENTIAL).', '') ('TRANSMEM', 59, 79, '2 (POTENTIAL).', '') ('DOMAIN', 80, 93, 'EXTRACELLULAR (POTENTIAL).', '') ('TRANSMEM', 94, 116, '3 (POTENTIAL).', '') ('DOMAIN', 117, 137, 'CYTOPLASMIC (POTENTIAL).', '') ('TRANSMEM', 138, 158, '4 (POTENTIAL).', '') ('DOMAIN', 159, 192, 'EXTRACELLULAR (POTENTIAL).', '') ('TRANSMEM', 193, 213, '5 (POTENTIAL).', '') ('DOMAIN', 214, 260, 'CYTOPLASMIC (POTENTIAL).', '') ('TRANSMEM', 261, 281, '6 (POTENTIAL).', '') ('DOMAIN', 282, 294, 'EXTRACELLULAR (POTENTIAL).', '') ('TRANSMEM', 295, 315, '7 (POTENTIAL).', '') ('DOMAIN', 316, 388, 'CYTOPLASMIC (POTENTIAL).', '') ('CARBOHYD', 7, 7, 'N-LINKED (GLCNAC...) (POTENTIAL).', '') ('DISULFID', 93, 184, 'BY SIMILARITY.', '') ('LIPID', 329, 329, 'PALMITATE (BY SIMILARITY).', '') ('VARSPLIC', 169, 169, 'L -> LERSLNQGLGQDFHA (IN ISOFORM 5- HT4(F)).', '') ('VARSPLIC', 359, 388, 'RDAVECGGQWESQCHPPATSPLVAAQPSDT -> SGCSPVSSFLLLFCNRPVPV (IN ISOFORM 5-HT4(E)).', '') ('VARSPLIC', 359, 388, 'RDAVECGGQWESQCHPPATSPLVAAQPSDT -> SSGTETDRRNFGIRKRRLTKPS (IN ISOFORM 5-HT4(D)).', '') ('VARSPLIC', 360, 388, 'DAVECGGQWESQCHPPATSPLVAAQPSDT -> F (IN ISOFORM 5-HT4(C)).', '') ('VARSPLIC', 360, 388, 'DAVECGGQWESQCHPPATSPLVAAQPSDT -> YTVLHRGHHQELEKLPIHNDPESLESCF (IN ISOFORM 5- HT4(A)).', '') ***References: authors: Blondel O., Gastineau M., Dahmoune Y., Langlois M., Fischmeister R.; title: "Cloning, expression, and pharmacology of four human 5- hydroxytryptamine receptor isoforms produced by alternative splicing in the carboxyl terminus."; references: [('PubMed', '9603189')] authors: Van den Wyngaert I., Gommeren W., Jurzak M., Verhasselt P., Gordon R., Leysen J., Luyten W., Bender E.; title: "Cloning and expression of 5-HT4 receptor species and splice variants."; references: [] authors: Claeysen S., Faye P., Sebben M., Lemaire S., Bockaert J., Dumuis A.; title: "Cloning and expression of human 5-HT4S receptors. Effect of receptor density on their coupling to adenylyl cyclase."; references: [('PubMed', '9351641')] authors: Claeysen S., Sebben M., Becamel C., Bockaert J., Dumuis A.; title: "Novel brain-specific 5-HT4 receptors splice variants show marked constitutive activity: role of the c-terminal intracellular domain."; references: [] authors: Bender E., Pindon A., van Oers I., Zhang Y.B., Gommeren W., Verhasselt P., Jurzak M., Leysen J., Luyten W.; title: "Structure of the human serotonin 5-HT4 receptor gene and cloning of a novel 5-HT4 splice variant."; references: [('PubMed', '10646498')] authors: Ullmer C., Schmuck K., Kalkman H.O., Lubbert H.; title: "Expression of serotonin receptor mRNAs in blood vessels."; references: [('MEDLINE', '95385798'), ('PubMed', '7656980')] testing sp011... *Using SequenceParser P16235 LSHR_RAT LUTROPIN-CHORIOGONADOTROPIC HORMONE RECEPTOR PRECURSOR (LH/CG-R) (LSH-R) (LUTEINIZING HORMONE RECEPTOR). Seq('MGRRVPALRQLLVLAVLLLKPSQLQSRELSGSRCPEPCDCAPDGALRCPGPRAGLARLSL ...', ProteinAlphabet()) *Using RecordParser LSHR_RAT ['P16235', 'P70646', 'Q63807', 'Q63808', 'Q63809'] ['Eukaryota', 'Metazoa', 'Chordata', 'Craniata', 'Vertebrata', 'Euteleostomi', 'Mammalia', 'Eutheria', 'Rodentia', 'Sciurognathi', 'Muridae', 'Murinae', 'Rattus'] (700, 78035, '31807E73BAC94F1F') ***Features: ('SIGNAL', 1, 26, '', '') ('CHAIN', 27, 700, 'LUTROPIN-CHORIOGONADOTROPIC HORMONE RECEPTOR.', '') ('DOMAIN', 27, 362, 'EXTRACELLULAR (POTENTIAL).', '') ('TRANSMEM', 363, 390, '1 (POTENTIAL).', '') ('DOMAIN', 391, 399, 'CYTOPLASMIC (POTENTIAL).', '') ('TRANSMEM', 400, 422, '2 (POTENTIAL).', '') ('DOMAIN', 423, 443, 'EXTRACELLULAR (POTENTIAL).', '') ('TRANSMEM', 444, 466, '3 (POTENTIAL).', '') ('DOMAIN', 467, 486, 'CYTOPLASMIC (POTENTIAL).', '') ('TRANSMEM', 487, 509, '4 (POTENTIAL).', '') ('DOMAIN', 510, 529, 'EXTRACELLULAR (POTENTIAL).', '') ('TRANSMEM', 530, 551, '5 (POTENTIAL).', '') ('DOMAIN', 552, 574, 'CYTOPLASMIC (POTENTIAL).', '') ('TRANSMEM', 575, 598, '6 (POTENTIAL).', '') ('DOMAIN', 599, 609, 'EXTRACELLULAR (POTENTIAL).', '') ('TRANSMEM', 610, 631, '7 (POTENTIAL).', '') ('DOMAIN', 632, 700, 'CYTOPLASMIC (POTENTIAL).', '') ('REPEAT', 52, 75, 'LRR 1.', '') ('REPEAT', 126, 150, 'LRR 2.', '') ('REPEAT', 152, 175, 'LRR 3.', '') ('REPEAT', 176, 200, 'LRR 4.', '') ('REPEAT', 202, 224, 'LRR 5.', '') ('REPEAT', 225, 248, 'LRR 6.', '') ('REPEAT', 250, 271, 'LRR 7.', '') ('DISULFID', 443, 518, 'BY SIMILARITY.', '') ('CARBOHYD', 103, 103, 'N-LINKED (GLCNAC...) (POTENTIAL).', '') ('CARBOHYD', 178, 178, 'N-LINKED (GLCNAC...) (POTENTIAL).', '') ('CARBOHYD', 199, 199, 'N-LINKED (GLCNAC...) (POTENTIAL).', '') ('CARBOHYD', 295, 295, 'N-LINKED (GLCNAC...) (POTENTIAL).', '') ('CARBOHYD', 303, 303, 'N-LINKED (GLCNAC...) (POTENTIAL).', '') ('CARBOHYD', 317, 317, 'N-LINKED (GLCNAC...) (POTENTIAL).', '') ('VARSPLIC', 83, 132, 'MISSING (IN ISOFORM 1950).', '') ('VARSPLIC', 133, 157, 'MISSING (IN ISOFORM 1759).', '') ('VARSPLIC', 184, 700, 'MISSING (IN ISOFORM C2).', '') ('VARSPLIC', 232, 251, 'DISSTKLQALPSHGLESIQT -> PCRATGWSPFRRSSPCLPTH (IN ISOFORM 2075).', '') ('VARSPLIC', 232, 293, 'MISSING (IN ISOFORM E/A2, ISOFORM EB AND ISOFORM B1).', '') ('VARSPLIC', 252, 700, 'MISSING (IN ISOFORM 2075).', '') ('VARSPLIC', 294, 367, 'QNFSFSIFENFSKQCESTVRKADNETLYSAIFEENELSGWDYDYGFCSPKTLQCAPEPDAFNPCEDIMGYAFLR -> IFHFPFLKTSPNNAKAQLEKQITRRFIPPSLRRMNSVAGIMIMASVHPRHSNVLQNQMLSTPVKILWAMPSLGS (IN ISOFORM B1 AND ISOFORM B3).', '') ('VARSPLIC', 294, 294, 'Q -> P (IN ISOFORM C1).', '') ('VARSPLIC', 295, 700, 'MISSING (IN ISOFORM C1).', '') ('VARSPLIC', 321, 342, 'YSAIFEENELSGWDYDYGFCSP -> LHGALPAAHCLRGLPNKRPVL (IN ISOFORM 1834, ISOFORM 1759 AND ISOFORM EB).', '') ('VARSPLIC', 343, 700, 'MISSING (IN ISOFORMS 1834, ISOFORM 1759 AND ISOFORM EB).', '') ('VARSPLIC', 368, 700, 'MISSING (IN ISOFORM B1 AND ISOFORM B3).', '') ('VARIANT', 82, 82, 'I -> M (IN ISOFORM 1950).', '') ('VARIANT', 179, 179, 'E -> G (IN ISOFORM 1759).', '') ('VARIANT', 233, 233, 'I -> T (IN ISOFORM 1950).', '') ('VARIANT', 646, 646, 'G -> S (IN ISOFORM 1950).', '') ('MUTAGEN', 409, 409, 'D->N: SIGNIFICANT REDUCTION OF BINDING.', '') ('MUTAGEN', 436, 436, 'D->N: NO CHANGE IN BINDING OR CAMP PROD.', '') ('MUTAGEN', 455, 455, 'E->Q: NO CHANGE IN BINDING OR CAMP PROD.', '') ('MUTAGEN', 582, 582, 'D->N: NO CHANGE IN BINDING OR CAMP PROD.', '') ('CONFLICT', 33, 33, 'R -> L (IN REF. 7).', '') ***References: authors: McFarland K.C., Sprengel R., Phillips H.S., Koehler M., Rosemblit N., Nikolics K., Segaloff D.L., Seeburg P.H.; title: "Lutropin-choriogonadotropin receptor: an unusual member of the G protein-coupled receptor family."; references: [('MEDLINE', '89332512'), ('PubMed', '2502842')] authors: Aatsinki J.T., Pietila E.M., Lakkakorpi J.T., Rajaniemi H.J.; title: "Expression of the LH/CG receptor gene in rat ovarian tissue is regulated by an extensive alternative splicing of the primary transcript."; references: [('MEDLINE', '92347604'), ('PubMed', '1353463')] authors: Koo Y.B., Slaughter R.G., Ji T.H.; title: "Structure of the luteinizing hormone receptor gene and multiple exons of the coding sequence."; references: [('MEDLINE', '91209270'), ('PubMed', '2019252')] authors: Bernard M.P., Myers R.V., Moyle W.R.; title: "Cloning of rat lutropin (LH) receptor analogs lacking the soybean lectin domain."; references: [('MEDLINE', '91006819'), ('PubMed', '1976554')] authors: Segaloff D.L., Sprengel R., Nikolics K., Ascoli M.; title: "Structure of the lutropin/choriogonadotropin receptor."; references: [('MEDLINE', '91126285'), ('PubMed', '2281186')] authors: Tsai-Morris C.H., Buczko E., Wang W., Dufau M.L.; title: "Intronic nature of the rat luteinizing hormone receptor gene defines a soluble receptor subspecies with hormone binding activity."; references: [('MEDLINE', '91060531'), ('PubMed', '2174034')] authors: Roche P.C., Ryan R.J.; title: "Purification, characterization, and amino-terminal sequence of rat ovarian receptor for luteinizing hormone/human choriogonadotropin."; references: [('MEDLINE', '89174723'), ('PubMed', '2925659')] authors: Ji I., Ji T.H.; title: "Asp383 in the second transmembrane domain of the lutropin receptor is important for high affinity hormone binding and cAMP production."; references: [('MEDLINE', '91332007'), ('PubMed', '1714448')] testing sp012... *Using SequenceParser Q9Y736 Q9Y736 UBIQUITIN. Seq('MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN ...', ProteinAlphabet()) *Using RecordParser Q9Y736 ['Q9Y736'] ['Eukaryota', 'Fungi', 'Ascomycota', 'Pezizomycotina', 'Eurotiomycetes', 'Onygenales', 'Arthrodermataceae', 'mitosporic Arthrodermataceae', 'Trichophyton'] (153, 17238, '01153CF30C2DEDFF') ***Features: ***References: authors: Kano R., Nakamura Y., Watanabe S., Hasegawa A.; title: "Trichophyton mentagrophytes mRNA for ubiquitin."; references: [] authors: Kano R.; title: "Microsporum canis mRNA for ubiquitin, complete cds."; references: [] testing sp013... *Using SequenceParser P82909 P82909 MITOCHONDRIAL 28S RIBOSOMAL PROTEIN S36 (MRP-S36). Seq('MGSKMASASRVVQVVKPHTPLIRFPDRRDNPKPNVSEALRSAGLPSHSSVISQHSKGSKS ...', ProteinAlphabet()) *Using RecordParser P82909 ['P82909'] ['Eukaryota', 'Metazoa', 'Chordata', 'Craniata', 'Vertebrata', 'Euteleostomi', 'Mammalia', 'Eutheria', 'Primates', 'Catarrhini', 'Hominidae', 'Homo'] (102, 11335, '83EF107B42E2FCFD') ***Features: ***References: authors: Strausberg R.; title: references: [] authors: Koc E.C., Burkhart W., Blackburn K., Moseley A., Spremulli L.L.; title: "The small subunit of the mammalian mitochondrial ribosome. Identification of the full complement ribosomal proteins present."; references: [] testing sp014... *Using SequenceParser P12166 PSBL_ORYSA PHOTOSYSTEM II REACTION CENTER L PROTEIN (PSII 5 KDA PROTEIN). Seq('TQSNPNEQNVELNRTSLYWGLLLIFVLAVLFSNYFFN', ProteinAlphabet()) *Using RecordParser PSBL_ORYSA ['P12166', 'P12167', 'Q34007'] ['Eukaryota', 'Viridiplantae', 'Embryophyta', 'Tracheophyta', 'Spermatophyta', 'Magnoliophyta', 'Liliopsida', 'Poales', 'Poaceae', 'Ehrhartoideae', 'Oryzeae', 'Oryza'] (37, 4366, 'CC537AEC50B2C784') ***Features: ('INIT_MET', 0, 0, '', '') ***References: authors: Sugiura M.; title: references: [] authors: Hiratsuka J., Shimada H., Whittier R., Ishibashi T., Sakamoto M., Mori M., Kondo C., Honji Y., Sun C.-R., Meng B.-Y., Li Y.-Q., Kanno A., Nishizawa Y., Hirai A., Shinozaki K., Sugiura M.; title: "The complete sequence of the rice (Oryza sativa) chloroplast genome: intermolecular recombination between distinct tRNA genes accounts for a major plastid DNA inversion during the evolution of the cereals."; references: [('MEDLINE', '89364698'), ('PubMed', '2770692')] authors: Sugiura M.; title: references: [] authors: Shinozaki K., Ohme M., Tanaka M., Wakasugi T., Hayashida N., Matsubayashi T., Zaita N., Chunwongse J., Obokata J., Yamaguchi-Shinozaki K., Ohto C., Torazawa K., Meng B.Y., Sugita M., Deno H., Kamogashira T., Yamada K., Kusuda J., Takaiwa F., Kato A., Tohdoh N., Shimada H., Sugiura M.; title: "The complete nucleotide sequence of the tobacco chloroplast genome: its gene organization and expression."; references: [] authors: Chaudhuri S., Maliga P.; title: "Sequences directing C to U editing of the plastid psbL mRNA are located within a 22 nucleotide segment spanning the editing site."; references: [('MEDLINE', '97076156'), ('PubMed', '8918473')] authors: Chakhmakhcheva O.G., Andreeva A.V., Buryakova A.A., Reverdatto S.V., Efimov V.A.; title: "Nucleotide sequence of the barley chloroplast psbE, psbF genes and flanking regions."; references: [('MEDLINE', '89240046'), ('PubMed', '2654886')] authors: Efimov V.A., Andreeva A.V., Reverdatto S.V., Chakhmakhcheva O.G.; title: "Photosystem II of rye. Nucleotide sequence of the psbB, psbC, psbE, psbF, psbH genes of rye and chloroplast DNA regions adjacent to them."; references: [('MEDLINE', '92207253'), ('PubMed', '1804121')] authors: Webber A.N., Hird S.M., Packman L.C., Dyer T.A., Gray J.C.; title: "A photosystem II polypeptide is encoded by an open reading frame co-transcribed with genes for cytochrome b-559 in wheat chloroplast DNA."; references: [] authors: Kudla J., Igloi G.L., Metzlaff M., Hagemann R., Koessel H.; title: "RNA editing in tobacco chloroplasts leads to the formation of a translatable psbL mRNA by a C to U substitution within the initiation codon."; references: [('MEDLINE', '92191997'), ('PubMed', '1547774')] authors: Zolotarev A.S., Kolosov V.L.; title: "Nucleotide sequence of the rye chloroplast DNA fragment, comprising psbE and psbF genes."; references: [('MEDLINE', '89160331'), ('PubMed', '2646599')] authors: Kolosov V.L., Klezovich O.N., Abdulaev N.G., Zolotarev A.S.; title: "Photosystem II of rye. Nucleotide sequence of genes psbE, psbF, psbL and OPC40 of chloroplast DNA."; references: [('MEDLINE', '90073796'), ('PubMed', '2686655')] authors: Haley J., Bogorad L.; title: references: [] authors: Maier R.M., Neckermann K., Igloi G.L., Koessel H.; title: "Complete sequence of the maize chloroplast genome: gene content, hotspots of divergence and fine tuning of genetic information by transcript editing."; references: [('MEDLINE', '95395841'), ('PubMed', '7666415')] authors: Willey D.L., Gray J.C.; title: "Two small open reading frames are co-transcribed with the pea chloroplast genes for the polypeptides of cytochrome b-559."; references: [('MEDLINE', '89354671'), ('PubMed', '2766383')] authors: Bock R., Hagemann R., Koessel H., Kudla J.; title: "Tissue- and stage-specific modulation of RNA editing of the psbF and psbL transcript from spinach plastids -- a new regulatory mechanism?"; references: [('MEDLINE', '93360903'), ('PubMed', '8355656')] authors: Hermann R.G., Alt J., Schiller B., Widger W.R., Cramer W.A.; title: "Nucleotide sequence of the gene for apocytochrome b-559 on the spinach plastid chromosome: implications for the structure of the membrane protein."; references: [] authors: Kuntz M., Camara B., Weil J.-H., Schantz R.; title: "The psbL gene from bell pepper (Capsicum annuum): plastid RNA editing also occurs in non-photosynthetic chromoplasts."; references: [('MEDLINE', '93099270'), ('PubMed', '1463853')] authors: Forsthoefel N.R., Cushman J.C.; title: "Characterization and expression of photosystem II genes (psbE, psbF, and psbL) from the facultative crassulacean acid metabolism plant Mesembryanthemum crystallinum."; references: [('MEDLINE', '94345017'), ('PubMed', '8066140')] authors: Kubo T., Yanai Y., Kinoshita T., Mikami T.; title: "The chloroplast trnP-trnW-petG gene cluster in the mitochondrial genomes of Beta vulgaris, B. trigyna and B. webbiana: evolutionary aspects."; references: [('MEDLINE', '95254673'), ('PubMed', '7736615')] authors: Naithani S.; title: references: [] authors: Ikeuchi M., Takio K., Inoue Y.; title: "N-terminal sequencing of photosystem II low-molecular-mass proteins. 5 and 4.1 kDa components of the O2-evolving core complex from higher plants."; references: [('MEDLINE', '89121082'), ('PubMed', '2644131')] authors: Zheleva D., Sharma J., Panico M., Morris H.R., Barber J.; title: "Isolation and characterization of monomeric and dimeric CP47-reaction center photosystem II complexes."; references: [('MEDLINE', '98298118'), ('PubMed', '9632665')] testing sp015... *Using SequenceParser IPI00383150 IPI00383150.2 Seq('MSFQAPRRLLELAGQSLLRDQALAISVLDELPRELFPRLFVEAFTSRRCEVLKVMVQAWP ...', ProteinAlphabet()) *Using RecordParser IPI00383150.2 ['IPI00383150'] ['Eukaryota', 'Metazoa', 'Chordata', 'Craniata', 'Vertebrata', 'Euteleostomi', 'Mammalia', 'Eutheria', 'Primates', 'Catarrhini', 'Hominidae', 'Homo'] (457, 52856, '5C3151AAADBDE232') ***Features: ***References: