! / 858081610 0 0 0 460 ` ( f)333****2f2f2f2f2fDRQQQQ]]l$impalcimpmlcimpccrimpcuiimpcvtimpdbzimpdtaimpdtsstrrsubimperrimppsqimpexeimpfinimpglnimprblimpgstimprdiimprdlimprdldimprclimpfbkimpgusimpinsimprpdimplngimplngdimpladimplfdimpletimplltimplhshimplonimpstrchrimpstrstrimpsncmlimpsncmpimp_readimpopnimprdhimpsevimpalc.o/ 857973150 200 100 100644 2488 ` L#3H .text4$ .data44h@.bss.comment4Pu uU鐐u uU鐐u uU鐐u uU鐐GEEE9Etujjt ujgEuujjQ EU뱐cEEE9Etuh4h  jYujEuuhhh jYEU땐 IMP-00006: failed to allocate memory of size %lu IMP-00006: failed to allocate memory of size %luxpg4plus @(#) stddef.h 20.1 94/12/04 xpg4plus @(#) stdlib.h 20.1 94/12/04 xpg4plus @(#) string.h 20.1 94/12/04 xpg4plus @(#) limits.h 20.2 94/12/15 @(#) types.h 25.16 95/02/03 @(#) param.h 25.21 95/01/24 @(#) sysmacros.h 25.6 94/09/22 @(#) ipc.h 25.4 94/09/22 @(#) shm.h 25.10 94/11/30 @(#) sem.h 25.4 94/09/22 @(#) cilock.h 25.7 94/09/22 xpg4plus @(#) stdio.h 20.1 94/12/04 @(#) stat.h 25.15 94/11/30 xpg4plus @(#) memory.h 20.1 94/12/04 xpg4plus %Z% %M% %I% %E% %Q%xpg4plus @(#) errno.h 20.1 94/12/04 @(#) errno.h 25.4 94/04/06 xpg4plus @(#) unistd.h 20.1 94/12/04 @(#) unistd.h 25.13 94/11/11 xpg4plus @(#) fcntl.h 20.1 94/12/04 @(#) fcntl.h 25.5 94/09/22 xpg4plus @(#) time.h 20.2 95/01/04 @(#) timeb.h 23.1 91/03/03 xpg4plus @(#) signal.h 20.3 94/12/19 @(#) signal.h 25.12 95/04/03 @(#) siginfo.h 25.9 94/11/10 xpg4plus @(#) grp.h 20.1 94/12/04 xpg4plus @(#) pwd.h 20.1 94/12/04 xpg4plus @(#) setjmp.h 20.1 94/12/04 @(#) file.h 25.4 94/09/22 @(#) utsname.h 25.4 94/09/22 xpg4plus @(#) stdarg.h 20.1 94/12/04 acomp: Release 5.0.0a 16Mar95 %A]  .filegimpalc.cstat$fstat$lstat8$T$ impalcplQ impmlclm.text4.data4h.bss.comment4__stat32"imperrcalloc__iobfprintfexit__c0__fstat32__lstat32statlstat__statlstat32impccr.o/ 857973156 200 100 100644 2212 ` L#3X.text:  .data@.bss.comment4u uU鐐u uU鐐u uU鐐u uU鐐hE PYE PuWs 5E P5 WE P5uK=u3EW/YE_UPW두xpg4plus @(#) stddef.h 20.1 94/12/04 xpg4plus @(#) stdlib.h 20.1 94/12/04 xpg4plus @(#) string.h 20.1 94/12/04 xpg4plus @(#) limits.h 20.2 94/12/15 @(#) types.h 25.16 95/02/03 @(#) param.h 25.21 95/01/24 @(#) sysmacros.h 25.6 94/09/22 @(#) ipc.h 25.4 94/09/22 @(#) shm.h 25.10 94/11/30 @(#) sem.h 25.4 94/09/22 @(#) cilock.h 25.7 94/09/22 xpg4plus @(#) stdio.h 20.1 94/12/04 @(#) stat.h 25.15 94/11/30 xpg4plus @(#) memory.h 20.1 94/12/04 xpg4plus %Z% %M% %I% %E% %Q%xpg4plus @(#) errno.h 20.1 94/12/04 @(#) errno.h 25.4 94/04/06 xpg4plus @(#) unistd.h 20.1 94/12/04 @(#) unistd.h 25.13 94/11/11 xpg4plus @(#) fcntl.h 20.1 94/12/04 @(#) fcntl.h 25.5 94/09/22 xpg4plus @(#) time.h 20.2 95/01/04 @(#) timeb.h 23.1 91/03/03 xpg4plus @(#) signal.h 20.3 94/12/19 @(#) signal.h 25.12 95/04/03 @(#) siginfo.h 25.9 94/11/10 xpg4plus @(#) grp.h 20.1 94/12/04 xpg4plus @(#) pwd.h 20.1 94/12/04 xpg4plus @(#) setjmp.h 20.1 94/12/04 @(#) file.h 25.4 94/09/22 @(#) utsname.h 25.4 94/09/22 xpg4plus @(#) stdarg.h 20.1 94/12/04 acomp: Release 5.0.0a 16Mar95 %A]x .filegimpccr.cstat$fstat$lstat8$T$ impccrp$q .text .data.bss.comment4__stat32"impalcmemcpyimpenvlxgcnvfree__c0__fstat32__lstat32statlstat__statlstat32impcui.o/ 857973161 200 100 100644 2630 ` L#3!.textp .data@.bss.comment4<u uU鐐u uU鐐u uU鐐u uU鐐 =}tmu ujjjphaPh S=Pt(u ujjjph1P5P"=u jj u YPu jjtu jj X}tRujjjshPh =Pt%ujjjshP5P Uxpg4plus @(#) stddef.h 20.1 94/12/04 xpg4plus @(#) stdlib.h 20.1 94/12/04 xpg4plus @(#) string.h 20.1 94/12/04 xpg4plus @(#) limits.h 20.2 94/12/15 @(#) types.h 25.16 95/02/03 @(#) param.h 25.21 95/01/24 @(#) sysmacros.h 25.6 94/09/22 @(#) ipc.h 25.4 94/09/22 @(#) shm.h 25.10 94/11/30 @(#) sem.h 25.4 94/09/22 @(#) cilock.h 25.7 94/09/22 xpg4plus @(#) stdio.h 20.1 94/12/04 @(#) stat.h 25.15 94/11/30 xpg4plus @(#) memory.h 20.1 94/12/04 xpg4plus %Z% %M% %I% %E% %Q%xpg4plus @(#) errno.h 20.1 94/12/04 @(#) errno.h 25.4 94/04/06 xpg4plus @(#) unistd.h 20.1 94/12/04 @(#) unistd.h 25.13 94/11/11 xpg4plus @(#) fcntl.h 20.1 94/12/04 @(#) fcntl.h 25.5 94/09/22 xpg4plus @(#) time.h 20.2 95/01/04 @(#) timeb.h 23.1 91/03/03 xpg4plus @(#) signal.h 20.3 94/12/19 @(#) signal.h 25.12 95/04/03 @(#) siginfo.h 25.9 94/11/10 xpg4plus @(#) grp.h 20.1 94/12/04 xpg4plus @(#) pwd.h 20.1 94/12/04 xpg4plus @(#) setjmp.h 20.1 94/12/04 @(#) file.h 25.4 94/09/22 @(#) utsname.h 25.4 94/09/22 xpg4plus @(#) stdarg.h 20.1 94/12/04 acomp: Release 5.0.0a 16Mar95 %A]q x 49BGPafpu  .filegimpcui.cstat$fstat$lstat8$T$ impcuip  .text.data.bss.comment4__stat32"impenvimpmhdlmsagbf__iobfprintfimperrstrlenupicui__c0__fstat32__lstat32statlstat__statlstat32impcvt.o/ 857973167 200 100 100644 2620 ` L#3".text .data<L@.bss8.comment  4u uU鐐u uU鐐u uU鐐u uU鐐wGj3hjj2hE Pue2*hu>+E=t= tE f8Whu _UW냐}=u8GHPGHPGHPGPGPG-dPhu ?GHPGHPGHPGPGPG-dP-dPhu $u zY_UWa%02d%02d%02d%02d%02d%02d%02d%02d%02d%02d%02d%02d%02dxpg4plus @(#) stddef.h 20.1 94/12/04 xpg4plus @(#) stdlib.h 20.1 94/12/04 xpg4plus @(#) string.h 20.1 94/12/04 xpg4plus @(#) limits.h 20.2 94/12/15 @(#) types.h 25.16 95/02/03 @(#) param.h 25.21 95/01/24 @(#) sysmacros.h 25.6 94/09/22 @(#) ipc.h 25.4 94/09/22 @(#) shm.h 25.10 94/11/30 @(#) sem.h 25.4 94/09/22 @(#) cilock.h 25.7 94/09/22 xpg4plus @(#) stdio.h 20.1 94/12/04 @(#) stat.h 25.15 94/11/30 xpg4plus @(#) memory.h 20.1 94/12/04 xpg4plus %Z% %M% %I% %E% %Q%xpg4plus @(#) errno.h 20.1 94/12/04 @(#) errno.h 25.4 94/04/06 xpg4plus @(#) unistd.h 20.1 94/12/04 @(#) unistd.h 25.13 94/11/11 xpg4plus @(#) fcntl.h 20.1 94/12/04 @(#) fcntl.h 25.5 94/09/22 xpg4plus @(#) time.h 20.2 95/01/04 @(#) timeb.h 23.1 91/03/03 xpg4plus @(#) signal.h 20.3 94/12/19 @(#) signal.h 25.12 95/04/03 @(#) siginfo.h 25.9 94/11/10 xpg4plus @(#) grp.h 20.1 94/12/04 xpg4plus @(#) pwd.h 20.1 94/12/04 xpg4plus @(#) setjmp.h 20.1 94/12/04 @(#) file.h 25.4 94/09/22 @(#) utsname.h 25.4 94/09/22 xpg4plus @(#) stdarg.h 20.1 94/12/04 acomp: Release 5.0.0a 16Mar95 %A]w|.6ow  .filegimpcvt.cstat$fstat$lstat8$T$ impcvtp  cvtdat$.text.data<.bss8.comment 4__stat32"cvtbuflmxclrlnxnucmemcpyimpenvsprintfstrlen__c0__fstat32__lstat32statlstat__statlstat32impdbz.o/ 857973172 200 100 100644 2524 ` L#3H".textLX* .dataLL$@.bsspp.commenttt4$u uU鐐u uU鐐u uU鐐u uU鐐jhL5jvt jjfj,EPXEЉEEfE5j5t jj%EPj5jt jj5j jj@=tEU0,select blocksize from sys.exu7bszxpg4plus @(#) stddef.h 20.1 94/12/04 xpg4plus @(#) stdlib.h 20.1 94/12/04 xpg4plus @(#) string.h 20.1 94/12/04 xpg4plus @(#) limits.h 20.2 94/12/15 @(#) types.h 25.16 95/02/03 @(#) param.h 25.21 95/01/24 @(#) sysmacros.h 25.6 94/09/22 @(#) ipc.h 25.4 94/09/22 @(#) shm.h 25.10 94/11/30 @(#) sem.h 25.4 94/09/22 @(#) cilock.h 25.7 94/09/22 xpg4plus @(#) stdio.h 20.1 94/12/04 @(#) stat.h 25.15 94/11/30 xpg4plus @(#) memory.h 20.1 94/12/04 xpg4plus %Z% %M% %I% %E% %Q%xpg4plus @(#) errno.h 20.1 94/12/04 @(#) errno.h 25.4 94/04/06 xpg4plus @(#) unistd.h 20.1 94/12/04 @(#) unistd.h 25.13 94/11/11 xpg4plus @(#) fcntl.h 20.1 94/12/04 @(#) fcntl.h 25.5 94/09/22 xpg4plus @(#) time.h 20.2 95/01/04 @(#) timeb.h 23.1 91/03/03 xpg4plus @(#) signal.h 20.3 94/12/19 @(#) signal.h 25.12 95/04/03 @(#) siginfo.h 25.9 94/11/10 xpg4plus @(#) grp.h 20.1 94/12/04 xpg4plus @(#) pwd.h 20.1 94/12/04 xpg4plus @(#) setjmp.h 20.1 94/12/04 @(#) file.h 25.4 94/09/22 @(#) utsname.h 25.4 94/09/22 xpg4plus @(#) stdarg.h 20.1 94/12/04 acomp: Release 5.0.0a 16Mar95 %A]q y ' F  .filegimpdbz.cstat$fstat$lstat8$T$ impdbzp/ .textL.dataL$.bssp.commentt4__stat32"selbszLimpenvupiosqimperrlmxclrupiexeupiad1upifchupioep__cp0__fstat32__lstat32statlstat__statlstat32impdta.o/ 857973181 200 100 100644 24429 ` L#3&Xc.text)9W .data))( T*T_@.bss44.comment444|5u uU鐐u uU鐐u uU鐐u uU鐐:5(,PpD@Dž8ƅ3`PFY\P9YXP,YEP"YEPYEPYLPYEPY0ƅpEh Yu@Dhth E EE@Dh EPu=u DžX DžXt t Dž` Dž`=u PPuu Dž`h-h-3EEEƅgDž\\t\=t\jj ?jYt!jj-jjs\jj_ }tLu ED}t}tDžXE5YUDž\HPLPV i`\@DuEPt3<@Duuu <tKDž`t5Dž,t=55pEPPtPnY@Dž,,u)EPNY+ЃEPhp.V5 O.V(Yfnn‹ G+(4+(h4hPh8h(tC4(h(u`uXuVYƅ3=Gu9=+Fj@Dh.WQtuuV1Yus`uj=t\F @DhtYPhtWt-@DuYPuWtVY+VYfnn‹$G+(4+(h4hPh8h(BtI4(h($Gu`u=tVY}u`u=tVYYu0=t'u= V YVY#Vjj :L=(w$)(@(8-(PVhM-[^_UTWVSluD*#55pw7Vu?u؋E WEW =LtE E 85pj"S C5pj"S C55pEPhS=E+E;Es,E@0t Eܸ5EPXE܍[}t:URMI  EAEСUfP@u5EPijh1S u E[^_U0WVS} j"uj"FPEPEPEPEPEPEPEPh1Vq$EEGEGEG EGEGEGEGj"FP6VG P'}tIGGG GGGGG 2 JHJH<GG<GG<GG<GG^_U WVh2u9E}t2EPh2E@P` tuh2EPH Eh2uE}tE}t6E p E pE pE @ PEPE puh2u$U,G55pjuh 3u&55pjE@Ph(3u"55pj uh03kuYh<3uE}t@5pj"E@ P7 E}u3 E+E@Pj u 3U,j"uj"GPEE+@PWXP E+ƄYYPhT3hL34PXP4PhX3|Po|Pu]_UWVu3ۅu -Y55pEPhV55pEPhu E ]5WEPWEPuFE+E;Es,E@0t Eܸ5EPE܍vE܊uE܊uBE+E;Es,E@0t Eܸ5EPDE܍vK[^_UXWVSPu} ;55p7Vu@>x?u3@@@?u3^_UWV멐3255phx3EPuEPh3u{=u jjhu]Y@EF55ph3EP0uEPh3u=u jjuY@EF]55ph3EPuEPh3u=u jjuY@EK55ph3EPluEPh3uU=u jjBu7Y@EK55ph3EP uEPh3u=u jjuY@EK:E=  = c= ==)hqED;E~t2VEPh4uf=u jjSE@2-Vh$4u8 =u jj%EDEPE PDuh(4u=u jj[^_UWVS]u ;55pEPhW=E+E;Es,E@0t Eܸ5EPjE܍}t:URMI  EAEСUfP@u5EPiE܊u3;}t:URMI  EAEСUfP@u&5EPtDSE܊uBE+E;Es,E@0t Eܸ5EPCE܃G[^_U0WVSXn5pj(u tCG5pj)W +PWP +ƄFƅ }ƅ5pj"W G5pj"W +PWPs +ƄF5pj"WQ G5pj"W= +PWP& +ƄPtP4PPh,48P8PYPh\48P 8PY^_U4WVw}uj"W Euj"EEPm EEE(uu uh4WGW>YЉUE+EPj u% _U W뀐PEE U+EEPjEPEPEURtEU +UEU +U}EUDEuE0E}uOjj,qEUjEURPEPuE 0E03luEEP=tEPEEPEUE UEUEU +UE@EEEuE0E}uOjj,EUjEURsEPuE 0E03uEEP==t>}t8uEE؁vffPS+uՋEUEUE UEPY} [^_UWVS@]u };sPS+}tEPxY}t[^_UWVS븐R 0 Z  gww   T h '$}yS $ # = - z ...... . . . / / ,/%T/ d/ p//&///!/%//0 0(0<0L0\0t0|0 00000"0'0"0 1"01 H1 T1 (d1$t1$1 $11111 1111#109241ALTER SESSION SET CURRENT_SCHEMA= "%s"PCTINCREASESYSTEMSYSTEMCREATE FORCE VIEWREUSE CONNECT %s; REM ... %ld rowsBEGIN END;CREATE PROCEDURECREATE TRIGGER "%s""PUBLIC"ENDTABLETABLEINSERTCONNECTCREATE TABLESPACECREATE TABLE CREATE INDEXCREATE UNIQUE INDEXCREATE BITMAP INDEXCREATE VIEWCREATE CLUSTERCREATE SPACE DEFINITION "EXPDEFSPACE"CREATE SPACECREATE USERCREATE TRIGGERCREATE FORMAT71TRIGCREATE PACKAGECREATE FUNCTIONCREATE PROCEDURECREATE FORMAT71CREATE ROLLBACKCREATE PUBLIC ROLLBACKCREATE PUBLIC SYNONYMCREATE SYNONYMCREATE SNAPSHOT LOGCREATE SNAPSHOTCREATE SEQUENCECREATE DATABASE LINKCREATEGRANT CONNECTGRANT RESOURCEGRANTDROP DATABASE LINKDROPANALYZE TABLEANALYZE INDEXANALYZE CLUSTERALTER SESSION SET LABELALTER SESSION SET MLS_LABEL_FORMATALTER SPACE DEFINITIONALTER TABLEALTER TRIGGERALTER PROCEDUREALTER FUNCTIONALTER PACKAGEALTERBEGINSYSENDSYSAUDITCOMMENT DEFAULTCOMMENTEXITREVOKEEXECUTEADD%*[^0123456789]%ld%*[^0123456789]%ld%*[^0123456789]%ld %*[^0123456789]%ld%*[^0123456789]%ld%*[^0123456789]%ld %*[^0123456789]%ld"SYSTEM" SIZE %dSIZE %d SPACE "EXPDEFSPACE"%s PCTFREE %ld %s TABLESPACE %s STORAGE (INITIAL %ld NEXT %ld MAXEXTENTS %ld)CREATEUSERALTER TABLETABLESPACE "%s%s"I_CREATE INDEX %s ON CLUSTER %sREM %sCREATE TABLE "%s".REM %sCREATE CLUSTER "%s". %sCREATE INDEX "%s". %sCREATE UNIQUE INDEX "%s". %sCREATE BITMAP INDEX "%s". %s%s %s ;ALTER USER "%s" QUOTA %s ON "%s"UNLIMITEDGRANT CREATE TABLE,CREATE CLUSTER,CREATE SEQUENCE,CREATE TRIGGER,CREATE PROCEDURE TO "%s"%s "%s"."%s"xpg4plus @(#) stddef.h 20.1 94/12/04 xpg4plus @(#) stdlib.h 20.1 94/12/04 xpg4plus @(#) string.h 20.1 94/12/04 xpg4plus @(#) limits.h 20.2 94/12/15 @(#) types.h 25.16 95/02/03 @(#) param.h 25.21 95/01/24 @(#) sysmacros.h 25.6 94/09/22 @(#) ipc.h 25.4 94/09/22 @(#) shm.h 25.10 94/11/30 @(#) sem.h 25.4 94/09/22 @(#) cilock.h 25.7 94/09/22 xpg4plus @(#) stdio.h 20.1 94/12/04 @(#) stat.h 25.15 94/11/30 xpg4plus @(#) memory.h 20.1 94/12/04 xpg4plus %Z% %M% %I% %E% %Q%xpg4plus @(#) errno.h 20.1 94/12/04 @(#) errno.h 25.4 94/04/06 xpg4plus @(#) unistd.h 20.1 94/12/04 @(#) unistd.h 25.13 94/11/11 xpg4plus @(#) fcntl.h 20.1 94/12/04 @(#) fcntl.h 25.5 94/09/22 xpg4plus @(#) time.h 20.2 95/01/04 @(#) timeb.h 23.1 91/03/03 xpg4plus @(#) signal.h 20.3 94/12/19 @(#) signal.h 25.12 95/04/03 @(#) siginfo.h 25.9 94/11/10 xpg4plus @(#) grp.h 20.1 94/12/04 xpg4plus @(#) pwd.h 20.1 94/12/04 xpg4plus @(#) setjmp.h 20.1 94/12/04 @(#) file.h 25.4 94/09/22 @(#) utsname.h 25.4 94/09/22 xpg4plus @(#) stdarg.h 20.1 94/12/04 acomp: Release 5.0.0a 16Mar95 .%/A0]1q&x2}22233333333 45 2'682=7S2X2]8g2~282222& ((9:&J2\:h;v:6::<6=&& &&"&'&@>m>2?8&> 2>+252:2??I2d2m82@ABC22@A2C>(DE88P&[&g2&2&2&&2&2)7KF&22(GH IE&"2-2;(C?LET2e(j?r&z2&(&J772:KLL#26JEKXLjL2E&2&2H 2 & E &( &- 27 2s I ( G E & & & 2 2 & E & E E 2( HB 2G &O &c & E & 2 E 2 & 2 2 E 2 & 2 E &( 22 E8 &B 2_ 2l Er & & & & & & 2 2 E & & &. 2; &B 2M &S 2Z &u > 8 ( 2 C : H 2 & 2 &# 2( &G EM &c 2h 8r 2 2 2 2 2 > 2 2 2 &&2%E+&4&A&N&T2[&HH22@ABC2 @%A/24CH@MAVB[Cd2v@{A2C22<(BC2(2C2(2C:!&/2JMd@iArBwC2@A2C<&27J72 :K%L7LM7[2c2k2tN72E&2&2"E(&R2_7m(sO(OE&(&72222&-2;2F2[2hEo2u&22&2222E2&JKD*P*WQ`*gQt2z2R22S&2>&i2x2T2U&2V&e2k2{>77(D7222 2%&82F2gEt&2(G&2E&2272F07;FHEN&U7o2z2222&2222E2E*222=2J&SE`:y(~22N&6&&(22F 2&(&028HD2LHX2^2mR2X2U2V &(Y;&A&OZ_Z([Z\(,282D2P2h&m&s({&([(D(&(D'&-&42:2D(IFV2\2j(oF|22(F(&2HI& &Z$Z>]Z(_(kD(D\&&&722R22R2,^^2gX2X&&22 >E &O &V 2\ 2a (j 8y ( C : 7 & 2 2 ( 8 ( C :!7!&!2 !2%!(.!8=!(E!CX!:c!7u!&|!2!2!(!8!(!C!:!7!&!2!2!(!8"( "C":'"7D"&O"&Z"&e"&p"&"("C":"("C":"&"&#( #C#:3#&9#&H#2N#2]#R#2#X#2#U#2#V#& $&$2E$UX$2a$V$2$X$&$&$&$2$H %2%H)%OV%2^%Hj%2r%H%O%2%H%2%H%O%(&(&D*&E7&(C&DR&Eg&&x&H&H&(&D&7&I&&$'_B'&Z'&v'`':'a'&'&'K'L(L'(&S(`h(:(a(&(&(K(L(L*)b5)&O)&l)K)b)&)&)&)&)&)&)&)&)&)&)&)&)&)&)&)&)&)&)&)&)&)&)&)&*&*&*& *&*&*&*&*& *&$*&(*&,*&0*&4*&8*&<*&@*&D*(T*(d*(t*(*(*(*(*(*(*(*(*(+(+($+(4+(D+(T+(d+(t+(+(+(+(+(+(+(+(+(,(,($,(4,(D,(T,(d,(t,(,(,(,(,(,(,(,(,(-(-($-(4-(D-(T-(d-(t-(-(-(  "$.filegimpdta.cstat$fstat$lstat8$T$ impdtap P impstt impspc@ ,imprspl impdts,"impcli strrsubl-chkusrlYDD  getword8#limpcqt$  impaosl&l"implcmd&"c$implskpT) J&.text).data)( _.bss4.comment44__stat32"impenvlcunooperrnoimposeimpjmppstrlenlxscopimpsevimperrupirolimprpdsetjmplxscmpimpcuiimpmhdlmsagbf__iobfprintfsprintfimpexeimpsncmp0:memsetimprdiimprblimpccpimpinsimpgstmemcpy__c4__ctypelxmcpenlxmopenlxmcpcxlxclaslxmspaxpreftabD*lxmfwdxstrncmpstrchrsscanfstrcpystrncpylxicmpimplngreallocimppsqimprdlQ__fstat32__lstat32statlstat__statlstat32impstrstrimpstrchrpretty_print imperr.o/ 857973188 200 100 100644 3894 ` Lġ#3l %.textN [ .dataP<@.bss.comment4u uU鐐u uU鐐u uU鐐u uU鐐}=@t0Whh l =PtWh5PO @jjjhPh  =Pt(jjjhP5P hPj t_= uƄPhh =PtPh5P` at\EEujjWh>Ph 0 =Pt*EEujjWh P5P =jhh 55jjjhPh =PtCjh5P 55jjjhrP5Pc=9jhh 1 55jjjhPh =PtCjh5P 55jjjhP5P} uj5_U W IMP-%05d: IMP-%05d: %s %s IMP-%05d: IMP-%05d: IMP-%05d: IMP-%05d: xpg4plus @(#) stddef.h 20.1 94/12/04 xpg4plus @(#) stdlib.h 20.1 94/12/04 xpg4plus @(#) string.h 20.1 94/12/04 xpg4plus @(#) limits.h 20.2 94/12/15 @(#) types.h 25.16 95/02/03 @(#) param.h 25.21 95/01/24 @(#) sysmacros.h 25.6 94/09/22 @(#) ipc.h 25.4 94/09/22 @(#) shm.h 25.10 94/11/30 @(#) sem.h 25.4 94/09/22 @(#) cilock.h 25.7 94/09/22 xpg4plus @(#) stdio.h 20.1 94/12/04 @(#) stat.h 25.15 94/11/30 xpg4plus @(#) memory.h 20.1 94/12/04 xpg4plus %Z% %M% %I% %E% %Q%xpg4plus @(#) errno.h 20.1 94/12/04 @(#) errno.h 25.4 94/04/06 xpg4plus @(#) unistd.h 20.1 94/12/04 @(#) unistd.h 25.13 94/11/11 xpg4plus @(#) fcntl.h 20.1 94/12/04 @(#) fcntl.h 25.5 94/09/22 xpg4plus @(#) time.h 20.2 95/01/04 @(#) timeb.h 23.1 91/03/03 xpg4plus @(#) signal.h 20.3 94/12/19 @(#) signal.h 25.12 95/04/03 @(#) siginfo.h 25.9 94/11/10 xpg4plus @(#) grp.h 20.1 94/12/04 xpg4plus @(#) pwd.h 20.1 94/12/04 xpg4plus @(#) setjmp.h 20.1 94/12/04 @(#) file.h 25.4 94/09/22 @(#) utsname.h 25.4 94/09/22 xpg4plus @(#) stdarg.h 20.1 94/12/04 acomp: Release 5.0.0a 16Mar95 %A]q {  3oty   ) / :?HMV`fkt z !  ! !! !%!05?DM!W i"n#  .filegimperr.cstat$fstat$lstat8$T$ imperrp  .text[.dataP.bss.comment4__stat32"impenv__iobfprintfupioepimpmhdlmsagbfupigmlvfprintfimposeerrnoimpjmpplongjmp__c0__fstat32__lstat32statlstat__statlstat32impexe.o/ 857973196 200 100 100644 8840 ` L̡#3?.text  .data   @.bss.comment  4u uU鐐u uU鐐u uU鐐u uU鐐}u k|55ph P]55pE@ PP;YP-E!jjE =t=t55pPhuj55pPjSEPRt+@G5PPg t uG[t uI1R  fAu$;t u Kt>t5DžEPh, h h =PtEPh4 5PH t uG[t uI1R  fAu$;t QtH+;s.@0t5P_UtWkj55ph< uCt@j55phH W!Et9}vE+Pj W 3_UPW'}E=Lt =tuW+55pjhX Wu;jj=W uG=jW5jm؅u55pj"hp W>ujW5j'55pj h WujW5jET55pjh WujW5jj5DjW5j=0t#@ tjj)guW=u5u =u$jj/uWjjHWYtL@Pjj uWOjj= ~h YuWGYt@Pjj uWjjrWYt@PjjF uWjj._Y=Hjh WN jh W> F> uF> tF8Ou>Nt3@Pjj( uW55pjh Wuuu@WYt@Pjj= uWjj%GfftPjj4 uWf@Pjj @Pjj uW(jj=-=\="h=.==q=`==C=3=-==W =G=s==6=Fg=`"-=^=]=_=,=xh={X=-= =.===O==.k=J=K M-=@==#===l=\=0k-=.=.2=."=01=0$=0[^_UPWVS*uu ut GNu?,u ^_UWVϐ55pj uh _uYh uKE}t@5pj)E@ P+ E}u3 E+E@Pj u 3Utjh5jt jjj,EPEEEfE5jt jjEPj5jkt jj[5jKf@fu(u2YPEPu$ u$3 @={u3 jjULALTER SCHEMA "%s" "%s"MAXEXTENTS PCTINCREASE ALTER SESSION SET LABELALTER SESSION SET MLS_LABEL_FORMATALTER SESSION SET CURRENT_SCHEMABEGIN 7.3.0.0.0ALTERINDEXDROPCREATE TABLECLUSTER "select * from sys.imp7uecxpg4plus @(#) stddef.h 20.1 94/12/04 xpg4plus @(#) stdlib.h 20.1 94/12/04 xpg4plus @(#) string.h 20.1 94/12/04 xpg4plus @(#) limits.h 20.2 94/12/15 @(#) types.h 25.16 95/02/03 @(#) param.h 25.21 95/01/24 @(#) sysmacros.h 25.6 94/09/22 @(#) ipc.h 25.4 94/09/22 @(#) shm.h 25.10 94/11/30 @(#) sem.h 25.4 94/09/22 @(#) cilock.h 25.7 94/09/22 xpg4plus @(#) stdio.h 20.1 94/12/04 @(#) stat.h 25.15 94/11/30 xpg4plus @(#) memory.h 20.1 94/12/04 xpg4plus %Z% %M% %I% %E% %Q%xpg4plus @(#) errno.h 20.1 94/12/04 @(#) errno.h 25.4 94/04/06 xpg4plus @(#) unistd.h 20.1 94/12/04 @(#) unistd.h 25.13 94/11/11 xpg4plus @(#) fcntl.h 20.1 94/12/04 @(#) fcntl.h 25.5 94/09/22 xpg4plus @(#) time.h 20.2 95/01/04 @(#) timeb.h 23.1 91/03/03 xpg4plus @(#) signal.h 20.3 94/12/19 @(#) signal.h 25.12 95/04/03 @(#) siginfo.h 25.9 94/11/10 xpg4plus @(#) grp.h 20.1 94/12/04 xpg4plus @(#) pwd.h 20.1 94/12/04 xpg4plus @(#) setjmp.h 20.1 94/12/04 @(#) file.h 25.4 94/09/22 @(#) utsname.h 25.4 94/09/22 xpg4plus @(#) stdarg.h 20.1 94/12/04 acomp: Release 5.0.0a 16Mar95 %A ]!q}""#""$#%" "&)"/"A'r""(""+)*""*" "`"l+"","",-&".5"AIP"V"]c.t/"0"""."0"". "0$"*"17.G"N0]"f"m1w~"2%""%%32%)%19"EJU_d2r%~%2%%" /8>D2R%^g"mt"z".2%%44%2%$*28%DP%Xflw}   ' , 7 D I T Y d q ~                  $ / 4 ? E P ] j w |                   + 0 5 H X 5  " "  .  6 " 7 -   # "* 8: %H 9d "k :{ % " ; % " < 2 $ = 2 %  .filegimpexe.cstat$fstat$lstat8$T$ imppsqp - imprmv"timpexe 8impblkL  3impbcc "impuet ".text  .data .bss.comment 4__stat32"impenvlxscopstrlenimperrlxmcpenlxmopenlxmcpcx__iobfprintflxmfwdx0memsetimpsncmpmemchrupipseupiosdupioepimpdtsimpoerstrstrstrrsub:upiosqlmxclrupiexeupiad1upifchmemcmp__cD__fstat32__lstat32statlstat__statlstat32impstrstrimpstrchrimpfin.o/ 857973202 200 100 100644 2828 ` Lҡ#30&.text' .data@.bss.comment4Xu uU鐐u uU鐐u uU鐐u uU鐐'}tj}Y=t5jf=t jSYjIY}ujj9}uW=@tNjjjvhPh =Pt"jjjvhP5PLjjjnhPh =Pt"jjjnhP5P5|Y5TpYugYUxpg4plus @(#) stddef.h 20.1 94/12/04 xpg4plus @(#) stdlib.h 20.1 94/12/04 xpg4plus @(#) string.h 20.1 94/12/04 xpg4plus @(#) limits.h 20.2 94/12/15 @(#) types.h 25.16 95/02/03 @(#) param.h 25.21 95/01/24 @(#) sysmacros.h 25.6 94/09/22 @(#) ipc.h 25.4 94/09/22 @(#) shm.h 25.10 94/11/30 @(#) sem.h 25.4 94/09/22 @(#) cilock.h 25.7 94/09/22 xpg4plus @(#) stdio.h 20.1 94/12/04 @(#) stat.h 25.15 94/11/30 xpg4plus @(#) memory.h 20.1 94/12/04 xpg4plus %Z% %M% %I% %E% %Q%xpg4plus @(#) errno.h 20.1 94/12/04 @(#) errno.h 25.4 94/04/06 xpg4plus @(#) unistd.h 20.1 94/12/04 @(#) unistd.h 25.13 94/11/11 xpg4plus @(#) fcntl.h 20.1 94/12/04 @(#) fcntl.h 25.5 94/09/22 xpg4plus @(#) time.h 20.2 95/01/04 @(#) timeb.h 23.1 91/03/03 xpg4plus @(#) signal.h 20.3 94/12/19 @(#) signal.h 25.12 95/04/03 @(#) siginfo.h 25.9 94/11/10 xpg4plus @(#) grp.h 20.1 94/12/04 xpg4plus @(#) pwd.h 20.1 94/12/04 xpg4plus @(#) setjmp.h 20.1 94/12/04 @(#) file.h 25.4 94/09/22 @(#) utsname.h 25.4 94/09/22 xpg4plus @(#) stdarg.h 20.1 94/12/04 acomp: Release 5.0.0a 16Mar95 %A]q   !$!49B G!P^cmr!{"#$  .filegimpfin.cstat$fstat$lstat8$T$ impfinp 4 .text'.data.bss.comment4__stat32"upicomimpenvupiclsupilofupidhsimperrimpmhdlmsagbf__iobfprintflxltermlxldfcbexit__c0__fstat32__lstat32statlstat__statlstat32impgln.o/ 857973208 200 100 100644 2678 ` Lء#3!.text .data@.bss.comment4u uU鐐u uU鐐u uU鐐u uU鐐nW|YI55pPhWUR+;s5@0t 5P  tMRI  AfP@Z5P;Ǎ+‰55p+PW[55pWu u4 E3_U8Wxpg4plus @(#) stddef.h 20.1 94/12/04 xpg4plus @(#) stdlib.h 20.1 94/12/04 xpg4plus @(#) string.h 20.1 94/12/04 xpg4plus @(#) limits.h 20.2 94/12/15 @(#) types.h 25.16 95/02/03 @(#) param.h 25.21 95/01/24 @(#) sysmacros.h 25.6 94/09/22 @(#) ipc.h 25.4 94/09/22 @(#) shm.h 25.10 94/11/30 @(#) sem.h 25.4 94/09/22 @(#) cilock.h 25.7 94/09/22 xpg4plus @(#) stdio.h 20.1 94/12/04 @(#) stat.h 25.15 94/11/30 xpg4plus @(#) memory.h 20.1 94/12/04 xpg4plus %Z% %M% %I% %E% %Q%xpg4plus @(#) errno.h 20.1 94/12/04 @(#) errno.h 25.4 94/04/06 xpg4plus @(#) unistd.h 20.1 94/12/04 @(#) unistd.h 25.13 94/11/11 xpg4plus @(#) fcntl.h 20.1 94/12/04 @(#) fcntl.h 25.5 94/09/22 xpg4plus @(#) time.h 20.2 95/01/04 @(#) timeb.h 23.1 91/03/03 xpg4plus @(#) signal.h 20.3 94/12/19 @(#) signal.h 25.12 95/04/03 @(#) siginfo.h 25.9 94/11/10 xpg4plus @(#) grp.h 20.1 94/12/04 xpg4plus @(#) pwd.h 20.1 94/12/04 xpg4plus @(#) setjmp.h 20.1 94/12/04 @(#) file.h 25.4 94/09/22 @(#) utsname.h 25.4 94/09/22 xpg4plus @(#) stdarg.h 20.1 94/12/04 acomp: Release 5.0.0a 16Mar95 %A]q  BT \hs   .filegimpgln.cstat$fstat$lstat8$T$ impglnp" .text.data.bss.comment4__stat32"getsimpenvlxmcpenlxmfwdxlxclaslxmspaxlxnrsplxncop__c0__fstat32__lstat32statlstat__statlstat32impgst.o/ 857973214 200 100 100644 6582 ` Lޡ#31.text  .data (h @.bss .comment 4 u uU鐐u uU鐐u uU鐐u uU鐐]u u3=DujhY @+H;s @+HWH4PS% +=H@9HuDHu3jY jj z[^_UWVS8EEE1=Du!jY UH55pEP<+44PH4PNj55pEPu u.E} 2@+H=}\@+HPY jj H55pEP<+44P54}t u8M}t}uA(URM܋  EfAuE$;tE+E;Es0E@0t Eظ5EP H E؃Hub}t,}t&EEEUEE EEO=tE +Pu3[A}t u8E}t}u9(URM܋  EfAuE="t t"?}t u8E}t}u9(URM܋  EfAuE='t t'}t u8E}t}u9(URM܋  EfAuE=/t tE/r}t u8E}t}u9(URM܋  EfAuE=*t tE=/u/E?;}t u8E}t}u9(URM܋  EfAuE=*t t E*}t u8E}t}u9(URM܋  EfAuE;t wtn}t u8E}t}u9(URM܋  EfAuE=/t t E=*u2E?}tEEUE؊@O5EPEPn + jj ^@H3&jj :[^_U`WVSj2jEPtEUMf3UPȐEPYt3=5E=u EfEfu E EU|cEoEdEPDYuEP6YtEEUMщ-E"EUE-=w$ 3UPEPYt3=5E=u EfEfu E EUyUElEaEPXYtPEUA=du E-EU"E=t=t=t=t3UPEPYt3ljj3}jj3oEPYuEPYtPEUMjj3*EUE=t=t=w3UPN} t\`=XuE+`35XE\K3u8h h =Pth 5P\h h =Pth 5PO\yh ~Y=Pt 5PiYXE`_UPWy ..xpg4plus @(#) stddef.h 20.1 94/12/04 xpg4plus @(#) stdlib.h 20.1 94/12/04 xpg4plus @(#) string.h 20.1 94/12/04 xpg4plus @(#) limits.h 20.2 94/12/15 @(#) types.h 25.16 95/02/03 @(#) param.h 25.21 95/01/24 @(#) sysmacros.h 25.6 94/09/22 @(#) ipc.h 25.4 94/09/22 @(#) shm.h 25.10 94/11/30 @(#) sem.h 25.4 94/09/22 @(#) cilock.h 25.7 94/09/22 xpg4plus @(#) stdio.h 20.1 94/12/04 @(#) stat.h 25.15 94/11/30 xpg4plus @(#) memory.h 20.1 94/12/04 xpg4plus %Z% %M% %I% %E% %Q%xpg4plus @(#) errno.h 20.1 94/12/04 @(#) errno.h 25.4 94/04/06 xpg4plus @(#) unistd.h 20.1 94/12/04 @(#) unistd.h 25.13 94/11/11 xpg4plus @(#) fcntl.h 20.1 94/12/04 @(#) fcntl.h 25.5 94/09/22 xpg4plus @(#) time.h 20.2 95/01/04 @(#) timeb.h 23.1 91/03/03 xpg4plus @(#) signal.h 20.3 94/12/19 @(#) signal.h 25.12 95/04/03 @(#) siginfo.h 25.9 94/11/10 xpg4plus @(#) grp.h 20.1 94/12/04 xpg4plus @(#) pwd.h 20.1 94/12/04 xpg4plus @(#) setjmp.h 20.1 94/12/04 @(#) file.h 25.4 94/09/22 @(#) utsname.h 25.4 94/09/22 xpg4plus @(#) stdarg.h 20.1 94/12/04 acomp: Release 5.0.0a 16Mar95 %!A"]#q$%$$$$$$&$$$$$%"'*:AW$a%pw$$$$$$$$($$)$$$$%'$#$)$2$8$>$E$J(Uy$$$*$$K+`+jp$$>c$$@$$$q$$,'$$'#/7$#$$  ' '+ 9 ` '    $ $  $  $ $ $  - . $ % $* .3 $< A -F .O $W ] $b .l $t y -~ / $ $ / $ $        .filegimpgst.cstat$fstat$lstat8$T$ imprblp$ impgst@$imprdi$:imprdl$imprdld$imprcl$impfbk  .text .data (.bss .comment 4__stat32"impenvimp_readmemcpyimperrlxmcpenlxmopenlxmfwdximpccplxmcpcx__iobfprintffflush__c 0__fstat32__lstat32statlstat__statlstat32impgus.o/ 857973219 200 100 100644 3116 ` L#3 #.textPb + .dataPP|@.bss.comment4u uU鐐u uU鐐u uU鐐u uU鐐jhP5jvt jjfjXEPXE EfEEtEfE5j t jjEPj5jt jj5jEf@ft%@={tjjEEU\jhx5jft jjVj,EPHEЉEEfE5j%t jjEPj5jt jj5jfxt jjEU07select userid,name from sys.exu7usruselect count(*) from sys.exu7ful where role = 'IMP_FULL_DATABASE'xpg4plus @(#) stddef.h 20.1 94/12/04 xpg4plus @(#) stdlib.h 20.1 94/12/04 xpg4plus @(#) string.h 20.1 94/12/04 xpg4plus @(#) limits.h 20.2 94/12/15 @(#) types.h 25.16 95/02/03 @(#) param.h 25.21 95/01/24 @(#) sysmacros.h 25.6 94/09/22 @(#) ipc.h 25.4 94/09/22 @(#) shm.h 25.10 94/11/30 @(#) sem.h 25.4 94/09/22 @(#) cilock.h 25.7 94/09/22 xpg4plus @(#) stdio.h 20.1 94/12/04 @(#) stat.h 25.15 94/11/30 xpg4plus @(#) memory.h 20.1 94/12/04 xpg4plus %Z% %M% %I% %E% %Q%xpg4plus @(#) errno.h 20.1 94/12/04 @(#) errno.h 25.4 94/04/06 xpg4plus @(#) unistd.h 20.1 94/12/04 @(#) unistd.h 25.13 94/11/11 xpg4plus @(#) fcntl.h 20.1 94/12/04 @(#) fcntl.h 25.5 94/09/22 xpg4plus @(#) time.h 20.2 95/01/04 @(#) timeb.h 23.1 91/03/03 xpg4plus @(#) signal.h 20.3 94/12/19 @(#) signal.h 25.12 95/04/03 @(#) siginfo.h 25.9 94/11/10 xpg4plus @(#) grp.h 20.1 94/12/04 xpg4plus @(#) pwd.h 20.1 94/12/04 xpg4plus @(#) setjmp.h 20.1 94/12/04 @(#) file.h 25.4 94/09/22 @(#) utsname.h 25.4 94/09/22 xpg4plus @(#) stdarg.h 20.1 94/12/04 acomp: Release 5.0.0a 16Mar95 %A]qy" 1!?!Sdi{  %!5K .filegimpgus.cstat$fstat$lstat8$T$ impgusp$ getdba".textP+.dataP|.bss.comment4__stat32"impenvupiosqimperrlmxclrupiexeupiad1upifchupioep__c0__fstat32__lstat32statlstat__statlstat32impins.o/ 857973226 200 100 100644 12287 ` L#3*P.textx)2 .dataxx,@.bss.comment4u uU鐐u uU鐐u uU鐐u uU鐐u E@0~U] uDžu EXj55p0Phu&j55pPhu30tI<Rt5Dž   EE?E EPYtEE?EEPhp5pdPa\PudPH j0P1YPdPP\PPudP[E==== z= =S=H=`N}t+} t%t!EE.EE.EE.E[^_UPWVS Ejj6EEP!YEPYE=uErPYNuuu hEPjEP5jtttjEPjj_ jjEE}=qfGfpjjjjjjG PjjpPV5j.4tpGttjEPjj jj-pPYpG pPYpGG =t G =u EGEG =Eu EG FE; }tLjjjuhcPh U=Pt"jjjuh9P5P*8-(UM J3||t]}tWDž|8-(UU++E=s"8-(UU++Ex Džx|t}x8l(hEdEUP8ۅ8t xٽ4f4f f6٭6r s%f6٭6۝0٭40858Y((Eldu hYs|~ Dž|EE}EG|EEFE;~޾}@EG =t G =uxExG |GEFE;~=3EEu*jhu ujj u u)jhu u3jj u ,u'jhup u3jj u[ EE8ijj5j8ju5j#tttjEPjjjj}fjjwG =juG Pw7V5j$tttjEPjjYjjFE;~EE}GE؋GUPE=dt EP/Y EP#Y}u+=t E E`w}uqG =t G =uMjjjG Pj7V5j$tt!jEPPj]jjEfEfUfG =tG =!E䉅lGd=dt>kPG =u3PdPlPScccu.kPEPPl`wjj jjjG Pl7V5ji$tt!jEPPjjj>E䉅l=dtEt lG9lv+G = = }=dEtyE䉅hE5hhShhE䍅hP~YhuhSehE苕hUf uSB uS4G = u= }uE=t%G =t G =`uEPS%jEPPuwjj FE;NE|9E.}pEuu5jptt3@PjjA jj53}>G PGM HPUWRj6?@%=>%@% %2 %l y ~ % %     ! %' %, 82 %7 %N A\ Bb  %  ' / CG DV ^ Cs D  C D  % E % :  ;> %E Fg s ;   % G H % = %D Fc o ;   % 2`o;%F;% %"(%/`I~JIII%KK4C;Vhr%LM;;MM %+38==>F?K@T%j3w=|>%@3=>?@%3=>% @#M:MCH_k;M6%N;%(N6;ABI_k7z7%7%GH%%3NU%H%%%I%JH.%5?NZmuHIKK"HDISKyKKGLI]KtKIKKK#J1<Iq .filegimpins.cstat$fstat$lstat8$T$ 0p  impted %impins  imprpdd/_impskr/implngt"kimplngd".textx2 .datax.bss.comment4__stat32"longjmpimpenvlxmopenlxclaslxmprixlxmcpcxlxmpuclxmfwdxlnxnuclxmcpenlxmspaxlxicopsetjmpldxinildxetistrlenldxstildxdtsimpfbkimprdiimpalcsprintfupiosqimperrupidscimpmhdlmsagbf__iobfprintfmemcpyfreestrncmpmemsetupisfeupibriimprdldimprdlimprblimprclimpccpupiexnupioepupicom__cI__fstat32__lstat32statlstat__statlstat32imp_err_handle.L1217.RO implab.o/ 857973233 200 100 100644 4528 ` L#3D..text H .data, @.bss$$.comment((4u uU鐐u uU鐐u uU鐐u uU鐐-}u f3 ffGNuù([^_UWVSːu VufEE؃;tP 9w uVu7 uu9w uVu7 u_jY؉_FPYs Vu3 0}t)E@PYCuus CU[^_UPWVS&T]u VSfEE9w uVS7C uGt?u3[^_UPWVS룐hf3U:=t7h 5 w7hh t?ufF=(|^_UWV두fDžhY Dž=tT=tJG?t2$=u$$u=#uw?ulKG='uf jj- -j'WuWYHf+ffDž cY=vjj/G PW 4 =uG==uJfGG?t2$=u$$uȋ!tfjj- !8uG='tjj-y j'WnuW[YHf+ffDž-Y=vjj/ PW =uGit4YP YP ]fjj- -=w$,5hPd =u.DYP 1YP [^_UWVSm T`'%s' '%s' = '%s' xpg4plus @(#) stddef.h 20.1 94/12/04 xpg4plus @(#) stdlib.h 20.1 94/12/04 xpg4plus @(#) string.h 20.1 94/12/04 xpg4plus @(#) limits.h 20.2 94/12/15 @(#) types.h 25.16 95/02/03 @(#) param.h 25.21 95/01/24 @(#) sysmacros.h 25.6 94/09/22 @(#) ipc.h 25.4 94/09/22 @(#) shm.h 25.10 94/11/30 @(#) sem.h 25.4 94/09/22 @(#) cilock.h 25.7 94/09/22 xpg4plus @(#) stdio.h 20.1 94/12/04 @(#) stat.h 25.15 94/11/30 xpg4plus @(#) memory.h 20.1 94/12/04 xpg4plus %Z% %M% %I% %E% %Q%xpg4plus @(#) errno.h 20.1 94/12/04 @(#) errno.h 25.4 94/04/06 xpg4plus @(#) unistd.h 20.1 94/12/04 @(#) unistd.h 25.13 94/11/11 xpg4plus @(#) fcntl.h 20.1 94/12/04 @(#) fcntl.h 25.5 94/09/22 xpg4plus @(#) time.h 20.2 95/01/04 @(#) timeb.h 23.1 91/03/03 xpg4plus @(#) signal.h 20.3 94/12/19 @(#) signal.h 25.12 95/04/03 @(#) siginfo.h 25.9 94/11/10 xpg4plus @(#) grp.h 20.1 94/12/04 xpg4plus @(#) pwd.h 20.1 94/12/04 xpg4plus @(#) setjmp.h 20.1 94/12/04 @(#) file.h 25.4 94/09/22 @(#) utsname.h 25.4 94/09/22 xpg4plus @(#) stdarg.h 20.1 94/12/04 acomp: Release 5.0.0a 16Mar95 %A] ! !"*";#T"f# ! $ $%%*&/%]v"(( G)OX*k++), (#(S)[)*++),'+:+G_)|$-++ .filegimplab.cstat$fstat$lstat8$T$ implhfp-7 implad implfdl_implet qimpllt\ .textH .data,.bss$.comment(4__stat32"implhshmemcmpimpalcmemcpyimpenvfprintf__iob__c$__ctypeimperrstrchrstrlenstrncatfgets0__fstat32__lstat32statlstat__statlstat32implon.o/ 857973239 200 100 100644 3214 ` L#3r ).text`LT 4 .data``@.bssdd.commenthh4u uU鐐u uU鐐u uU鐐u uU鐐u3uHjEPEPjjVfu-}t'55puuj]ht;jjhhPh h Y=Pt%jjhhP5Pj]htu jjhtYt*55ph`htuj~Y5pj/htk u tu *jhjjhh8PEP+7kjjG| jjFjj8jjhjhtj=t=t=t=t4^_U$WV.xpg4plus @(#) stddef.h 20.1 94/12/04 xpg4plus @(#) stdlib.h 20.1 94/12/04 xpg4plus @(#) string.h 20.1 94/12/04 xpg4plus @(#) limits.h 20.2 94/12/15 @(#) types.h 25.16 95/02/03 @(#) param.h 25.21 95/01/24 @(#) sysmacros.h 25.6 94/09/22 @(#) ipc.h 25.4 94/09/22 @(#) shm.h 25.10 94/11/30 @(#) sem.h 25.4 94/09/22 @(#) cilock.h 25.7 94/09/22 xpg4plus @(#) stdio.h 20.1 94/12/04 @(#) stat.h 25.15 94/11/30 xpg4plus @(#) memory.h 20.1 94/12/04 xpg4plus %Z% %M% %I% %E% %Q%xpg4plus @(#) errno.h 20.1 94/12/04 @(#) errno.h 25.4 94/04/06 xpg4plus @(#) unistd.h 20.1 94/12/04 @(#) unistd.h 25.13 94/11/11 xpg4plus @(#) fcntl.h 20.1 94/12/04 @(#) fcntl.h 25.5 94/09/22 xpg4plus @(#) time.h 20.2 95/01/04 @(#) timeb.h 23.1 91/03/03 xpg4plus @(#) signal.h 20.3 94/12/19 @(#) signal.h 25.12 95/04/03 @(#) siginfo.h 25.9 94/11/10 xpg4plus @(#) grp.h 20.1 94/12/04 xpg4plus @(#) pwd.h 20.1 94/12/04 xpg4plus @(#) setjmp.h 20.1 94/12/04 @(#) file.h 25.4 94/09/22 @(#) utsname.h 25.4 94/09/22 xpg4plus @(#) stdarg.h 20.1 94/12/04 acomp: Release 5.0.0a 16Mar95 %A]q } $.3 C!KP"[afkp#~$%&!!!$'J [  .filegimplon.cstat$fstat$lstat8$T$ implonp  .text`4.data`.bssd.commenth4__stat32"impenvlccgtslxncopimpmhdlmsagbf__iobfprintffflushimpglnimperrstrlenlxscmpimpfin0slspromupilon__cd:__fstat32__lstat32statlstat__statlstat32impstrchrimplut.o/ 857973245 200 100 100644 3170 ` L#3 %.text,T  .data,,@.bss,,.comment004u uU鐐u uU鐐u uU鐐u uU鐐}] 5uEPhWl}t u8E}t}u9(URM  EfAuE;t tNE+E;Es,E@0t Eܸ5EPE܍E܊S3[_U,WS] u}WVEPhuzEWVEPhSc}t'WSMYPEPSAYPEP6u,%WS&YPEPSYPEPuEKE+E;Es(E@0t Eܸ WEPEE܃EE܊b3[^_UXWVS[}uuEPWuEuuEPWu s9Et+}uWEPWEPO_U\W뜐[}uuEPWu$EuuEPWu 9Et+}uWEPWEP_U\W뜐xpg4plus @(#) stddef.h 20.1 94/12/04 xpg4plus @(#) stdlib.h 20.1 94/12/04 xpg4plus @(#) string.h 20.1 94/12/04 xpg4plus @(#) limits.h 20.2 94/12/15 @(#) types.h 25.16 95/02/03 @(#) param.h 25.21 95/01/24 @(#) sysmacros.h 25.6 94/09/22 @(#) ipc.h 25.4 94/09/22 @(#) shm.h 25.10 94/11/30 @(#) sem.h 25.4 94/09/22 @(#) cilock.h 25.7 94/09/22 xpg4plus @(#) stdio.h 20.1 94/12/04 @(#) stat.h 25.15 94/11/30 xpg4plus @(#) memory.h 20.1 94/12/04 xpg4plus %Z% %M% %I% %E% %Q%xpg4plus @(#) errno.h 20.1 94/12/04 @(#) errno.h 25.4 94/04/06 xpg4plus @(#) unistd.h 20.1 94/12/04 @(#) unistd.h 25.13 94/11/11 xpg4plus @(#) fcntl.h 20.1 94/12/04 @(#) fcntl.h 25.5 94/09/22 xpg4plus @(#) time.h 20.2 95/01/04 @(#) timeb.h 23.1 91/03/03 xpg4plus @(#) signal.h 20.3 94/12/19 @(#) signal.h 25.12 95/04/03 @(#) siginfo.h 25.9 94/11/10 xpg4plus @(#) grp.h 20.1 94/12/04 xpg4plus @(#) pwd.h 20.1 94/12/04 xpg4plus @(#) setjmp.h 20.1 94/12/04 @(#) file.h 25.4 94/09/22 @(#) utsname.h 25.4 94/09/22 xpg4plus @(#) stdarg.h 20.1 94/12/04 acomp: Release 5.0.0a 16Mar95 %A]q~%. H]e!!"!!#$ @Wp#" .filegimplut.cstat$fstat$lstat8$T$ 0pl :dlimpsncml\$fimpsncmp$f.text, .data,.bss,.comment04__stat32"impenvlxmcpenlxmfwdxstrlenlxicmplxicml__c,D__fstat32__lstat32statlstat__statlstat32impstrchrimpstrstrimpord.o/ 857973250 200 100 100644 3630 ` L#3 *.text O .data@.bss.comment4u uU鐐u uU鐐u uU鐐u uU鐐<+EE}tu@+E4Pu_ =Lu3545<5H< @} #=35Lus5HYjjh+hPh j EPu jhH=u 35LL+94s 4E35LL+‰Eu5<5H> @=@} @L9v L)E@=@~3DE4@U8} tju3} b=4u 44PmY88@%<<455puh2_UWexpg4plus @(#) stddef.h 20.1 94/12/04 xpg4plus @(#) stdlib.h 20.1 94/12/04 xpg4plus @(#) string.h 20.1 94/12/04 xpg4plus @(#) limits.h 20.2 94/12/15 @(#) types.h 25.16 95/02/03 @(#) param.h 25.21 95/01/24 @(#) sysmacros.h 25.6 94/09/22 @(#) ipc.h 25.4 94/09/22 @(#) shm.h 25.10 94/11/30 @(#) sem.h 25.4 94/09/22 @(#) cilock.h 25.7 94/09/22 xpg4plus @(#) stdio.h 20.1 94/12/04 @(#) stat.h 25.15 94/11/30 xpg4plus @(#) memory.h 20.1 94/12/04 xpg4plus %Z% %M% %I% %E% %Q%xpg4plus @(#) errno.h 20.1 94/12/04 @(#) errno.h 25.4 94/04/06 xpg4plus @(#) unistd.h 20.1 94/12/04 @(#) unistd.h 25.13 94/11/11 xpg4plus @(#) fcntl.h 20.1 94/12/04 @(#) fcntl.h 25.5 94/09/22 xpg4plus @(#) time.h 20.2 95/01/04 @(#) timeb.h 23.1 91/03/03 xpg4plus @(#) signal.h 20.3 94/12/19 @(#) signal.h 25.12 95/04/03 @(#) siginfo.h 25.9 94/11/10 xpg4plus @(#) grp.h 20.1 94/12/04 xpg4plus @(#) pwd.h 20.1 94/12/04 xpg4plus @(#) setjmp.h 20.1 94/12/04 @(#) file.h 25.4 94/09/22 @(#) utsname.h 25.4 94/09/22 xpg4plus @(#) stdarg.h 20.1 94/12/04 acomp: Release 5.0.0a 16Mar95 %A]qw !""'#5$FNS&[lrz &+:AR&diqz'( .filegimpord.cstat$fstat$lstat8$T$ imp_readp$ impopn@$.textO.data.bss.comment4__stat32"impenvmemcpyreaderrnoimposecloseimpmhdlmsagbf__iobfprintfimpglnimpfnamopenimpalclxscop__c0__fstat32__lstat32statlstat__statlstat32imprdh.o/ 857973254 200 100 100644 7226 ` L#3V3.text| P8 .data| | 0 @.bssh h .commentl l 4 u uU鐐u uU鐐u uU鐐u uU鐐=(Ed55peffu jj$NpRu jj&!hWt jj Gff$ f=uE$ $Ef=GEEfEf=,t~55,YP5,u ujj1eK555,IYP5,< P3E9Et jj*Z=,tk5,h| EP Eԅt+5EPYPEP 5jEP p5sf=tf=f=u tf=u@t7=,tjj+f=u f f[1=,uff5f jj%5P u jj&ff955 5a =tPPjj>}uJ5j5EPj5 h$=uPPjj=Du&d5p$PW Fh$PW u jj F=t+HPW5^Y@+Ћj 5SH toj h S4 t[j h S tGj h S t3j5FP u  jj jh S } jh S } jh S } jh Sb } jh SA } {jh S$ } ^jh S } Ajh0 S }  $jhD S }  c=dt[WjjjzhPh h Y=Pt#WjjjzhfP5PW YWjjjyhAPh 3 h &Y=Pt#Wjjjyh P5P 5p$PW F=t+HPWG=Du3U55pWu 5p$PWr F=t+HPWG=Rt jj 7=Eu 6=Uu #=Tu Pjj E8t=u jj 55pu httRu jjjmhPh =Pt%u jjjmhnP5P_ = D D5p$PW" F=~q5p$PW F=1uAGWY@+Ћڀ=t j hX S t jj [^_UPWVS.%sEXPORT:V06EXPORT:V05EXPORT:V04EXPORT:V05.00.15EXPORT:V05.01.13EXPORT:V06.00.00EXPORT:V06.00.20EXPORT:V07.00.00EXPORT:V07.00.07EXPORT:V07.00.09EXPORT:V07.01.00EXPORT:V07.03.00MLS:V00.00.00xpg4plus @(#) stddef.h 20.1 94/12/04 xpg4plus @(#) stdlib.h 20.1 94/12/04 xpg4plus @(#) string.h 20.1 94/12/04 xpg4plus @(#) limits.h 20.2 94/12/15 @(#) types.h 25.16 95/02/03 @(#) param.h 25.21 95/01/24 @(#) sysmacros.h 25.6 94/09/22 @(#) ipc.h 25.4 94/09/22 @(#) shm.h 25.10 94/11/30 @(#) sem.h 25.4 94/09/22 @(#) cilock.h 25.7 94/09/22 xpg4plus @(#) stdio.h 20.1 94/12/04 @(#) stat.h 25.15 94/11/30 xpg4plus @(#) memory.h 20.1 94/12/04 xpg4plus %Z% %M% %I% %E% %Q%xpg4plus @(#) errno.h 20.1 94/12/04 @(#) errno.h 25.4 94/04/06 xpg4plus @(#) unistd.h 20.1 94/12/04 @(#) unistd.h 25.13 94/11/11 xpg4plus @(#) fcntl.h 20.1 94/12/04 @(#) fcntl.h 25.5 94/09/22 xpg4plus @(#) time.h 20.2 95/01/04 @(#) timeb.h 23.1 91/03/03 xpg4plus @(#) signal.h 20.3 94/12/19 @(#) signal.h 25.12 95/04/03 @(#) siginfo.h 25.9 94/11/10 xpg4plus @(#) grp.h 20.1 94/12/04 xpg4plus @(#) pwd.h 20.1 94/12/04 xpg4plus @(#) setjmp.h 20.1 94/12/04 @(#) file.h 25.4 94/09/22 @(#) utsname.h 25.4 94/09/22 xpg4plus @(#) stdarg.h 20.1 94/12/04 acomp: Release 5.0.0a 16Mar95 %A]q x !17AH `fouz   &5@!Qb!r~"  $/8CLSY#anw~ $%&+29@'W^(p}))****)*!) 17*DJ RX*ek sy* * *** *)/*<EL[+`,i-n.v-{/+,.+,-.-/+,. '(;bhq0|'+4:BG1\+a,j-o.x+,.'  ' ( 6 @ F *V a x  .filegimprdh.cstat$fstat$lstat8$T$ imprdhp  .text| .data| .bssh .commentl 4__stat32"impenvlxhcsnimperrimprblimpccpstrlen0lxhh2cisprintf:lxhasclxhci2hlxgratiolxgcnvimpccrDmemchrimpseastrncmpimpmhdlmsagbf__iobfprintffflushlxscoplxscmp__ch N__fstat32__lstat32statlstat__statlstat32lxhchtoidlxhlntoidimpstrchrimpsev.o/ 857973259 200 100 100644 2488 ` L #3$".textH .dataD@.bss``.commentdd4u uU鐐u uU鐐u uU鐐u uU鐐hdEPjz hmYEuaYEu UYEPKYEu uhu4juuj"tf@f fujU ]alter session set events '%s trace name context forever, level %s'xpg4plus @(#) stddef.h 20.1 94/12/04 xpg4plus @(#) stdlib.h 20.1 94/12/04 xpg4plus @(#) string.h 20.1 94/12/04 xpg4plus @(#) limits.h 20.2 94/12/15 @(#) types.h 25.16 95/02/03 @(#) param.h 25.21 95/01/24 @(#) sysmacros.h 25.6 94/09/22 @(#) ipc.h 25.4 94/09/22 @(#) shm.h 25.10 94/11/30 @(#) sem.h 25.4 94/09/22 @(#) cilock.h 25.7 94/09/22 xpg4plus @(#) stdio.h 20.1 94/12/04 @(#) stat.h 25.15 94/11/30 xpg4plus @(#) memory.h 20.1 94/12/04 xpg4plus %Z% %M% %I% %E% %Q%xpg4plus @(#) errno.h 20.1 94/12/04 @(#) errno.h 25.4 94/04/06 xpg4plus @(#) unistd.h 20.1 94/12/04 @(#) unistd.h 25.13 94/11/11 xpg4plus @(#) fcntl.h 20.1 94/12/04 @(#) fcntl.h 25.5 94/09/22 xpg4plus @(#) time.h 20.2 95/01/04 @(#) timeb.h 23.1 91/03/03 xpg4plus @(#) signal.h 20.3 94/12/19 @(#) signal.h 25.12 95/04/03 @(#) siginfo.h 25.9 94/11/10 xpg4plus @(#) grp.h 20.1 94/12/04 xpg4plus @(#) pwd.h 20.1 94/12/04 xpg4plus @(#) setjmp.h 20.1 94/12/04 @(#) file.h 25.4 94/09/22 @(#) utsname.h 25.4 94/09/22 xpg4plus @(#) stdarg.h 20.1 94/12/04 acomp: Release 5.0.0a 16Mar95 %A]q    .filegimpsev.cstat$fstat$lstat8$T$ impsevp  .text.dataD.bss`.commentd4__stat32"setenvtupiopnstrlenimpalcsprintfupipseupioepimpoerupicls__c`0__fstat32__lstat32statlstat__statlstat32