ELF@4X4 (444jjdD}}   /lib/ld-linux.so.2GNUQ]pfw8TB{\cW.+ NP_ Z*b0 46t U<5=CmXR?D 2Yvh > S&-a,sy ' 9!7;%e@kM3gEO|/nq$I)VzlA KH^uFijdr(xoL"1G #[J:`}~<s 9 8& ,L<eL81 \;mlz0 |Q;f v g ̱ܱK @7 d,b</}Lt \)l |gut=*̲ܲ 6 84 47 7@,G<RLW\zl*C |/+7j*~̳p|ܳ# O" 1 7,V<L\lI|#H (!k̴/ܴ9$' I ,J <-L\(l7 |  !>:̵ܵB&6   ,:B<{NL"İ 3\< l:|597}=V"]̶U ܶd ]h4w,[ <L\B l* | \i :O̷"Q ܷZ%" U:;,(O <.%( E L:S\-l9|(=+L8w ! ̸%[ܸ$ Xi :_ , <:L\}lM|+= 5B:H̹=YܹOjAt9 i3,W <L\lCc |8{  A l̺ܺ ; + R,(</ 0& p La\l:|uB  o;'p 4 !6 ̻\c ܻ:Xa3 P7,u0`b o <L,(\, l;6|->*J|X  ̼ܼ; [ Q g[ ,- <L:2\u`l*b| 48% H * Ebi D=̽ܽ1 E! 6 l:j, <L8 \7l? $B|;Tr̾Pܾb:7 :  ,<xxL}" \tl# |=-7#G x& *̿2P ܿu6E cA'Q , libresolv.so.2__dn_expand_getlong__b64_pton__b64_ntop_getshort__res_query__gmon_start__libcrypto.so.0.9.8EVP_DigestInitEVP_enc_nullEVP_CIPHER_CTX_initBN_randRSA_generate_keyPEM_read_PrivateKeyEVP_DigestFinalBN_bin2bn_DYNAMICBN_CTX_newBN_value_oneSSLeay_versionEVP_aes_128_cbcBN_bn2binDSA_do_signBN_subOBJ_nid2snPEM_write_DSAPrivateKeyAES_set_encrypt_keyHMAC_FinalEVP_md5EVP_rc4OPENSSL_add_all_algorithms_noconfDSA_generate_keyRC4_set_keyRSA_signDH_generate_keyDH_sizeBN_hex2bnEVP_aes_192_cbcRSA_public_decryptEVP_aes_256_cbcBN_set_wordBN_num_bitsDSA_newDH_newSSLeayRC4DH_compute_keyEVP_sha1DSA_freeRSA_private_decryptEVP_CipherInitRSA_newCRYPTO_freeBN_divBN_bn2decEVP_ripemd160DSA_do_verifyEVP_PKEY_get1_DSAMD5_InitEVP_CIPHER_CTX_cleanupRAND_statusBN_dec2bnRSA_public_encryptERR_error_stringHMAC_CTX_cleanupMD5_FinalBN_is_bit_setEVP_DigestUpdatePEM_write_RSAPrivateKeyRAND_bytesBN_CTX_freeRSA_blinding_onEVP_cast5_cbcEVP_des_cbcAES_encryptDH_free_finiDSA_SIG_newRSA_freeDSA_SIG_freeERR_get_errorBN_copyBN_add_wordDSA_generate_parametersBN_dup_GLOBAL_OFFSET_TABLE_BN_lshiftEVP_CIPHER_CTX_set_key_lengthEVP_des_ede3_cbcERR_load_crypto_stringsEVP_PKEY_get1_RSABN_clear_freeHMAC_InitRSA_sizeBN_newEVP_PKEY_freeMD5_UpdateBN_cmpHMAC_UpdateEVP_bf_cbcEVP_get_digestbynamelibutil.so.1libz.so.1deflateinflateinflateInit_deflateInit_inflateEnddeflateEndlibnsl.so.1libpng12.so.0libjpeg.so.62libm.so.6libcrypt.so.1libXcomp.so.2NXTransFileNXTransSelectNXTransContinue__deregister_frame_infoNXTransExecuteNXTransPrepareNXTransRunningNXTransCreate__register_frame_infolibstdc++-libc6.2-2.so.3libc.so.6strcpysetrlimit64mkstemp64waitpidioctlgetgidstdoutcfgetospeedconnectsigemptysetfdopengeteuidmemmove__ctype_bgetenvgetegid__strtol_internalusleepgetprotobynamegetpidfgetsmemcpyexeclpcloseperrordup2getuidsystemfeofmallocremoveisattycfgetispeedvsnprintfrmdirsocketselectsetgroupsfflush__ctype_toupperstrncasecmpfreeaddrinfoabortgetnameinfoalarmpopenpipeacceptcfsetispeedrenamestrrchrcallocgai_strerrorwritefprintfkillstrcatbindinet_addrinitgroupssetsockoptcfsetospeedstdinumask__prognamestrstrsetgidreadopenlogsendmsgcloselogstrncmpstrncpyunlinksetenvstrcasecmprealloc__strduplistenforksscanfexecvsetresuidexeclpsigaction__res_init__xstat64gettimeofdaymemsetinet_ntoatcgetattrgetgroupsrresvport_afsyslogseteuidstrcmpshutdowngetpwuid__h_errno_location__res_stategethostbynamegetpwnamgetservbynamefgetcfclosestrcspngetpeernamestderr__lxstat64fputcgetsockoptgetaddrinfosocketpairsetresgidmkdtemprewind__errno_locationinet_ntopfileno_IO_stdin_used_exitstrspndaemon__libc_start_mainlseek64strchrsetegidrecvmsgfcntlsetuidtcsetattrmkdir__ctype_tolowersetlogin__fxstat64strpbrkgetsocknamefopen64program_invocation_short_name__environ_edata__bss_start_endGLIBC_2.2GLIBC_2.0GLIBC_2.10ii  ii  ii  ii  ii   t u$(,048<@ D H L P TX\`dhlptx| !"#$%&'()*+,-./0123456789:;<= >?@AB C$D(E,F0G4H8I<J@KDLHMLNPPTQXR\S`TdUhVlWpXtYxZ|\]^_`abcdefghijklmĀnȀòpЀqԀr؀s܀vwxyz{|~  $(,048<@DHLPTX\`dhlptx|āȁ́Ёԁ؁܁  $(,048<@DHLPTX\`dhlptx|ĂȂ̂ЂԂ؂܂    US[H[5% %$h%(h%,h%0h%4h %8h(%<h0%@h8p%Dh@`%HhHP%LhP@%PhX0%Th` %Xhh%\hp%`hx%dh%hh%lh%ph%th%xh%|h%hp%h`%hP%h@%h0%h %h%h%h%h%h%h%h%h %h(%h0%h8p%h@`%hHP%hP@%hX0%h` %hh%hp%hx%h%h%h%h%h%h%h%hp%h`%hP% h@%h0%h %h%h% h%$h%(h%,h%0h%4h %8h(%<h0%@h8p%Dh@`%HhHP%LhP@%PhX0%Th` %Xhh%\hp%`hx%dh%hh%lh%ph%th%xh%|h%hp%h`%hP%h@%h0%h %h%h%h%h%h%h%h%h %h(%h0%h8p%Āh@`%ȀhHP%̀hP@%ЀhX0%Ԁh` %؀hh%܀hp%hx%h%h%h%h%h%h%h%hp%h`%hP% h@%h0%h %h%h% h%$h%(h%,h%0h%4h %8h(%<h0%@h8p%Dh@`%HhHP%LhP@%PhX0%Th` %Xhh%\hp%`hx%dh%hh%lh%ph%th%xh%|h%hp%h`%hP%h@%h0%h %h%h%h%h%h%h%h%h %h(%h0%h8p%āh@`%ȁhHP%́hP@%ЁhX0%ԁh` %؁hh%܁hp%hx%h%h%h%h%h%h%h%hp%h`%hP% h@%h0%h %h%h% h%$h%(h%,h%0h%4h %8h(%<h0%@h8p%Dh@`%HhHP%LhP@%PhX0%Th` %Xhh%\hp%`hx%dh%hh%lh%ph%th%xh%|h%hp%h`%hP%h@%h0%h %h%h%h%h%h%h%h%h %h(%h0%h8p%Ăh@`%ȂhHP%̂hP@%ЂhX0%Ԃh` %؂hh%܂hp%hx%h%h%h%h1^PTRhBhİQVh|US[èt[ÉU=ju>jPjСj8ut h})jÐUULth h}CÐUÍUWVSDžEPShBShBEPƃ hBSt}V0EPhB5 t PP+PhC5 oDž^t&DžVTwt&G t;;} tPP$ vV à u;} tPj VËV=vt]VP EP"zEPPt\DžJVP PtEPE Ph@C5 [^_ÐUWVSDžh}~*E p,E u0k@9E 0k}~^U rN)PWbC~Ǎx[^_U WVS11;5$}E(CPsPh`N.5PCPsPchǃ F;5$|…~uhN蝆1;5ؠ}>ܠCPsPhOɆCPsPL F;5ؠ|Ǎe[^_ÉUWVS11=5h`OoHv hOPj%蚜5 |7蒹Ãu51!uhOɅ h PR=jhQPՅj  haPujHP躸]ShT5P څ}EBEPCP CPCP j5WPjYoÃu $uhP规 hP0=DhItlEPEPh Q菄 uujV߷Ãu &uh`Q hQ裮V賱=@{u @=@t_hQg\Ã肺~%h3h RPh R虃hUR$ thRwG=kt0jjZ}H0PhRj~h It~h 5Ã~h 'PShR j bh Ph P0+$hRςj  j=jtܘPWUAe[^_ÐU|WVSJ==]1ffEэqjlREP]kv hS}jjjLk}$0PhShT|jǃVS5k u@k~u5h T|PPhSh@T||W_j@5k u"0ePhShOT9|5kx[^_UVS]5j=DtKhIt7EPEPBh Qـ uuSR=@tAu @=@t%hQ荀jh`TSUV 轳h5h 5PjhaPP5k5jSO0V蛭e[^U WVS=ktjh{T jƃjǃjwà ||} hTzVu VpWu WTSu S8=jt @jhTjPRSWVjhTÃ0shTFsT =kujhsUCe[^_ÉUWVS]u1ffEэyjlSEPpYkv hS{yjjjx}"!0jPhTh U>yWVxRu%0/PShUy&haPƃujH]SqSxQU% uhTh6UxEP+thThCUxURt hUUixMQ$kEP  5jUR5kMQ VEPjhqUh  h PUR =t u"jMQ}|lfDžt1|l8tsh4QSWj=Pkt51;}(4VKu C;|tG<utRMQ18tph4pPVj=pRtL1;}?4Vu C;|t4MQ+G<t tiEPjxR!uhThsUvjxQG jxP6  jxR" MQ EPxRL"uhTh6UuMQthThU{uEPh`j= h`j~=hpjo= =jt.SDž|I~|hU)zu(tPPhThUt ku1jlRxQÃuhUy kt kPhUyxPDS=jt=th V5 |vU WVS}kk;ؠ}b@@3P3P:SQu2SPh`Sx Ru3PhS{xe[^_ÍvUWVS}EWOiFE t:t&;utE PP' EWà u;utE Pj WËuWFtEe[^_USV=kt  xtÃ=kt0jj}n0PhRrSjtܘRP16]U WVSEE;}o5pƃjVà tPVhTwpp EE;|e[^_ÉUVS˪ƃh Ã~A~%hbh RPh RXvhUR }duVh hPShSYqe[^ÉUE kÍvU$kv uPÉU,WVSuэY3Kt3PhJ\uމQǃ?uWhǃe[< S<#uJDkS1ۃ=@kt(4@kWtC<@kuWEPURh \tDžA$4cv]pWt8uEPURh`\ot&Qu}WEPh\~o]R4t8uMQ}Wh\Eot&Pu APuAPuQt\u [uBuBt\u1vMQ}Wh\nE8]]t&]t&]t&]4t&]8t&]<t&] t&]zt&]jt&]$Zt&](Jt&],:t&]0*t&]@t&]D t&]ü t&]HR#t8uMQ}Wh ]4mt&Pu APuAPuQt\u vuBuBt\u1HuBu BuBuMQ}Wh`]IlE8y]LRt8uMQ}Wh\kPu APuAPuQt\u WuBuBt\u1vMQ}Wh\KkE8{ ]PRt8uMQ}Wh\jPu APuAPuQt\u Yt&uBuBt\u1vMQ}Wh\KjE8 { ]T]\t&]X ]t t&]Xt&]T RtuMQ}Wh]i< vEPURh]it&jj PQ9u}WEPh]QiKt Gt)i t&Mt[ M E = Qt8u}WEPh]hU:d Mc~jd}WEPh]hUQ[} t&] ]ØPt8uURMQh])h}? ; P ]à둋]ä놐t&]ès]ìc]ÌS]ÐC]ð3]ô#]øuURMQh]Qgh^P}?UPM]dWtuEPURh]fv< vMQ}Wh]ft&jjPP;uMQ}Wh]afE8 ]lJt&Rt8uMQ}Wh] fPWVuRMQ}Wh@^eE8l Uzx_ JxW &Qit8u}WEPh]zeRKRuQ}WEPh^KeU:My|WUB|t&Qt8u}WEPh]dR_uQ}WEPh^dU:?M/WTUQ(t8u}WEPh]9dRzuQ}WEPh_ dU:MWUnQt8u}WEPh]cRi`u Q}WEPh@_gc&U:}PPk u"u"^PURMQh_b}?Ex`vH`nRt8uMQ}Wh_bPffuURMQh`ebt&Wt8uEPURh@`*bVShi`Qt3VShz`WtEPURh`avVƉfuMQ}Wh`aE84u{fw=t h`[jaUc~jdh[Ma@MfRCf{ Mc~jdh[`@}fR舿CfsEt&QYt8u}WEPh_j`RffuMQ}Wh a7`&E8fw=th`[`vUc~jdh[_v@Mf;hMa芾CfCEt&]L E&R9t68t1PM Qbht˃WhSa;dE1&]ÜRtuMQ}Wh]^<^uxu@d[t N9u tEPh`d`[EPhdS`Dž1+FPVEPSE PEP tWhSZuW ~PEPhdZx[^_ÉUS]hxjXSںCCC CCCC C(C,C0C4C8C<CC$C@CDCHCLCPCTC\CXCdChClCpCtCxC|ǃǃǃǃǃǃǃǃǃǃǃǃǃǃǃǃL C`ǃǃǃǃP ǃX ǃ\ ǃT ǃǃ` ǃd ǃh ǃlǃpǃt]ÉU WVSu>u~uF~uF~ uF d~uF~uF~uF~ uF ~(uF(~,uF,~0uF0~4uF4~8uF8~uF~$uF$~@uF@~DuFD~HuFH~LuFL~PuFP~TuFT~\uF\~XuFX~duFd~huFh~luFl~tuFtu džtDj hehej4襵 j说‹hehej4T jk‹h$ehej4 u dž~u dž@eu dž_eu džeu dže~`uF`L uh1;}!3B G;|dž1;}3 G;|džX u džX \ u dž\ P u džP T u džT u dž` u dž` d u džd pu džpe[^_ÉUVSUM ufw=t h`[zTc~jdh[`T@f uCfse[^UVSUM uc~jdh[ T@f u迲Cfse[^Í'US=kt0h"fXTjn m5豨PK j]S5葨P(u+h"fK=ub15hhhdS荪j Sڊà t0t< thiS豪uS PP]S VS蹟PS SjPRu9hIhhiOPQT S<U&EPu0hi`OPR MQ EPPRu)hIhh:iOPQ轟 URÃt6ShIhhUiNMQu PPo|j\LljEPOLMQ;LB TVMQhLBVMQRH LSHэAPHRSY MQǃvWhIhhqiQNtUPLBX1ۃ9s#VMQ‹LAXC9r݋LBXHQLp0hIhhiM PREPQqE PP\EPuuhIhhi`M0L:t>ЃPuu%ڟ0#PhIhh jL MQEPjPR u[hIhhiiLPQ uu uEPURu腧 uu#ueuuuEuuPQjhjjhhuuujh,jJËPC(@shIhh4jKs  LRhD8sz"([^_ÍvU,WVS1Dž/%jj{jhHjzǃ ?t DB tG?t DB u?-uGg5 Ã5 tmhxPhxP5 P臑à 9t M1ۃShxe[_UWVSuDžpDžtDžxDž|hmoAj]S觚EEEݝ`C5(q܅`ݝ`HLPTppǡ9}ǡkt9}ǃ=x65}Pg u5_P 5EP/ u5'P 5  P u5 P 5؏95Ïǃ5誏95蕏t&ǃ5 z95 et&@E DhXwhhj hxZ]jj th8jjjth8jjjth8j~}th7jf.=xt=5m=Dth,9VxmthT9PuEXh\1nt xDtho==xhXháy9vÃjSShXQPDp pShX~=Tt&hXujVSIphXt 9sP,stwmmh@f<=xt zt&]ShT5貌Py|Lj REPo CPnCPn CPnio=@bxV|PxPtPpP& =@'uXtpj=u Mjt/ho;n@DP? plpN =@=xupt= ttp=@uJ1=xtnPh@j詭=x=mKpt PDtt P.}tjjE}t25腊Po u5gP 5MP7 u5/Pu 5 P u5 P= =ktmumPmt:mPhoo4hp9Gh@p9I}=5hojdXPXэAPXQhx ]hhżPhh˼P5P輈à 4ShhhhkuchxLPhxRP5 |PCà ShxhhxuX1hXBhh5 hx%j\Pmۅl5(qhEEܥ`$555hp۽@g7 ۭ@EuV1҉EUm$EUm$EUm$hp6 lj5Phq6P([^_USEP5kÃKm~+hhGgPh`gb6hg` uShhujS蚑S]ÐUSEPjÃl~+h%hGgPh`g5hgm` uShxujSS~]ÐUVS=Duh r^5h`rQ5jjÃxthr51kil~%hhGgPh`g5hg_ VShs05Sώ +|/jh'sjh@hjPPjh'sq@41e[^ÍvU,WVS1ۃEPAiEhEhEhEPEPUREPhs40u rjhdhEjhƃ MhEj~%hphGgPh`g3hg^ URVEPWhq 4 EP|'jVjhhjPPj h rLÃ0VjWa UuBu BuBuEPURÃ}usui=@u!h@s2h`r21ۃ ?jh@qjhhjPPjh@q}@4Ã0EPhs2USE쉃xU|; j[HsSe sEe7e &eebEPhs[2j\H URdjd  xuhs3eh`q&e ReEP見e[^_ÉUWVSEeEjJfEeEPEPEPht1 }u h@t!EP)ÃuEPht'1u쿶t ReE m9MuEP9S(uQht0jEPRhGEg~%hhGgPh`g0hg6[ }t-d}tcPGEPXc cEP<e[^_U\WVS] EPhTuhju0]ShTuSڅ}EBjhtuUREu`qPcCPb EPbCPb CPb]ăSw EuPjsb =/}$%h|u}/EE$8vUE$4#Ãj=SK~DžuS)UBUGE1E@EF;5}4S2tE}uShu /S KWShu.jhuURy SaWa aSsEEU$<E PAÃ~}tfU R&PShu. }(%PhuEP}(tUU(RjdrE(Pjcd 4U RPShu- jhuEPzU RxPE PPr` `jhuUR5`e[^_USj諟h;j輟 hL<j誟hj蛟 h!j艟h#jz h=jhhx9jY hd,jGh+j8 TE؃=@t9Pj؃=DtHDPj]ÉU=xh谞h=ja hj^诞h j`蠞 hpj_莞h-jZ h!j[mh#j\^ h0jbLh>j]= h:jP+h@j h8jR h8jQ3=xt#h j՝h=jƝU=mt$5K{P葺m t=kt P=|uvUmh7jÍvUEm@ÐUMU EmPRQ@ÉU WVSu uhhh8hJ%EPǃuEPhhhg%h:vX^SwFPvv6EPpLJ0SBv胃 FXt61ۃ8t!FX4^CFX<uvXFV:e[^_ÉUEuu P\RPLRS)hqD(j> SZvZ c[e[^UVSjz\[ÃSVh u' tjR)>[SVke[^U WVS}[<^~,h[hGgPh`gS'hgQ &SƃuShghg&5cuShgV' t&duShg&V@e[^_ÍULWVS]S5wP襃uhivpwoE %EāeЄeEESj5vPxuh_v w me[^_ÍvUWVEǾ^_vU=mtChj5=vPTxuh_vv mÍt&U|WVS]E Ph1wj }WuV; jh5wV蠩EEEE;;%ujC<%ujh;wVlC\| }hwtsCp- .&6.u%hҎPUTt&tPh$Wu h nPw.0~%hh-Ph@ hu$ h%Ctt&jhFPjWrƃ=Ph`h,SSDž;5jP3Ã;t jSPjqDžhDž߰эAPjSuTSRu1u(h0;JPRuo=uhyjDžj5+y+$j,PT|vPFu VgPFT+uh`$%tPhj"h1[^_ÐUVS]u h@j# S*Fp2KPT*0Fp[*FpM* *#*u htPh!SÅu h/S>+-~*h[h-Ph@hu\! t&hvS3 SR2*uh@%tPh h1e[^ÉU WVShg1;5j' )H")ǃt(t(Wh@~ (thx ZPm*Ã,~%hh-Ph@hu%  j SDtFRShhWsO S'Oth=uhjW/Ã;uSNj)r S ߰эAPjS1PSN0( F(ǃu%tWh@F;5V1[^_ÐU WVSh=uh51;5thjEPz.Ãj ~  S߰эAPjS:OSM9'O'u )t&tPh !F;5U1e[^_ÍvULWVS1h`j&1ۃ E؉E̍UUH'M̈ C~jNEJ'ÃUԋBpO' MԋAp;'UԋBpF 9tSPhh jM&ÃFp& Fp&Fp8F 9tSPh bhU &P|$s&Ek&m(~*h h-Ph@hu t&FpEPMԋApEPh Vu uu hhȩEPUԋBpFp#p観1ۃu*ljEȈ C~NDžu h{jWD1ۃjWW{LUȊ2ȩ% M PW KC~FpUԋBpN|FpDÃMԋApoD考 9}9hUԋBpODPFp=DPh vMqWW,v~UԋBpDÃFpC考 9}=hFpCPMԋApCPh'&vWWC,EpWW3, UR_V_ u j#EЃtOCtj¡r%jGPhT MrPPh W&PPhU= j5!1ۃ UP!C~W!WJ j!("hm 5j MQ}1j"he[^_U\WVS}u=mu h_jE Pa! !H!.tPh mt9=Xt01;^})t8uPWC;^|mtM=\tD1;}-t8uS\C;|m t=ht=u u\mt?=tt6=u-uE PhTjP]SG Suhn&e[^_Ð&USEU ܩة=uht mm5m`m5mMm =tߝmmt mmĘtmt P#hmaC`CdChmCLmCPCTnSCDPj^nC n]U@WS=ht xjh  h-}tPh`Y!~(jǃWhV WD h;!~%hIhɞPhhQ h@=u (]̉1 S E E̋EEЋEEEaEh2‰UEEEEE u hNS%!hx\ hj4\htj3\ h j5\SEPj\ S!jjOj2\ =,kt3E0h5t:5: jiE0h e[_U WVS}u G0tPCG0uw1Gt PBwhKCVÃuc=(ku=,ku=4ku =8kt1h@5959 h膽Vh`_jjOjj@_ sh}jV*> j2d2y dp edB0R jdp0hhhS=0jS?ƃV эAPjV ?Vp=dr2hhhP= jhRƃdp0h hhRC= jhPÃSV3t;эAPjVL>V<h`1 ߰эAPjS>Su<VэAPjV=V5<j@ h}jtXǃj5E؃E1҉ljE؉p 3:6U؉BEBEUEM; |DEj]SW[EƃEE܍t&1ۋUU؅Mq V 9t_V}Kur5 ]؋t CB }؋GEE؋PUMABAQ]Zk}؋?}؅{uWuMjc4E؃‰׉E؉p EU؉BMJ]܋CBCSvj}WEP<ƃUU؅tOMt&]؋tCB }؋GAE؋PU]CBCS}}؅uUEP$MM؅tMM]؋tCB }؋GAE؋PU]CBCS}}؅uEE؅t%Ur rh6M؋ M؅uۍe[^_ÍvUWVSu1CPStCBCF SF CF ^ C 88shhEPEPs E uh 1t&h@zj*Eԃ ]SS5 n5nSR j2SQE0SR VSRUB0SR EPSRuuS>R WSRUrSR E؃xt2SSPSSPEPEPURO0t&SpSPSzSPEPEPEP@ƃ0UR?SR t,hW( ]S(1j2bE0 Ur ]C0 EPuu Ws uuujsu)u&(W( UR(e[^_UVSun4kt=tu =xtn=(kut=`ttn=,ktnt;t3V/t,;u=,ktuPh uPh`1e[^ÉUWS]t߰untPSt[Shvnt P&S&nnPhǪ8n ] ntSAtL8tGQ t :%t, t&hn1]S5n5nDǃtEnWh5nh WntPt:t@ t 8ЅwWh42Wh` =(ku =8kt"Wh5{5ne[_ÐUWVS]S'On=ntvtjFtc8t^V t :%tCS6OtjhSCO>эAP6S#O>ujhSOSNP$ƃ0S8Ne[^_ÉUu5ة5ܩcu hz1ÉUS]u h`yCtP$CC0tP#C0C]U WVS}u hjÃ~%hhɞPhhB thVh VW+e[^_ÍvUVShAjà jƃ=~ShW5 S"V"e[^Uuh"US]j2`3 s C0 +]ÐUVSuF$taP1S&t CBCF SC t P/8Ct P"S"^ue[^ÍvU WVS]sh 8` uh1uuu Ppe[^_UWVS5ƃVh  1 󫍽|pxt&txjjjRFPÉ| } 8t&hWV#É|} 8t؅~dhpPWh i|~5Ƅ(|W!Whk h Jt&hvX[^_ÐU WVSu EPXJMЃ=?vh@h@h<Rh2E0VUR,J hMQ 5HvjEP Ãt8URI‰)Ph@ SMQoE.^ShSWUR|JߋM@ EPaIÃSURƒ tM@);E~EPIPh"e[^_ÐU WVS} EPHÃEPH‰))à ShWEP4 u h@谿)ShCPƃ u h|SWV]3hd VSWEP h@:EP V" h e[^_ÐU<WVSu1@󫍽@󫍽@󫍽@󫍽󫉅@>7эA=h'V QPVXQV=PVQWVPSWQVX fPSVPNQWPV2WQVV  Ph pYjj jP$qPh phyt,Qh o h oh%DtQtHjj jP](qjj jPC,qP5(qh`@vtctZjj jP(qjj jP,qP5(qh`~Dvvt\tSPh pjj jPq$qh pPhDvh 1t tQ֍ 1t t5tQh@c֍ u&Ph@qh@qh_h.t)Qh@rh@rh@v[^_ÍvU WVSu1@󫍽@5HvhlhSh 达 S*WSVy u.WN)uAX)uQڅt[^_UWVS=@rtE@rEPhEh]Sjjj_}0Ph߸@q us*Ct&jusuh@葽EPjs } hhsuh!hLC qEe[^_ÐU,WVShjLEh p#E jE5$qh ph@袼 u/h puh ph`訷 t&CfE$qffEUEE}jjjÃuhSvjEPjjS } h)VjWS }]N~(5$qh ph 蠻SS 5$qh ph`ȶj>>5$qh ph蜻EPj~ EPwjS\؍e[^_ÉU WVS]=@vuF@q u0oE Ph  jE Pssh`sE P2 |sE P} h輵E P js jshR qPPssh 5 =ou oe[^_ÐU WVS= pt=$qt )=@vu&hv}5$qh ph`Դt&= otdh oPhŸh˸hSE0h ohN߰эAPSVr (q| =,q}5,qPh=oV[^_ÍvUS](q=,qsP8}% 0 Ps5(qh³s5(qh vs5,q}#S 0 Ps5,qhls5,qh "$t&5,q5(qh7&o]UWVSDžLDž\h p u(h puh ph`@DDuh ph`蘲jjjHu= 0 Ph_j\PjjHP } h/fE$qffEEjEPHRu& 0 P5$qhӱvjHQ{ u'x 0P5$qh 蔱t&h p5$qh`DpHH<<T4B,P8`0@1 󫋅<@1DžT4BRjjV,Q u0Ph谰<@ 2dǃbfDžP8P0RHQQÃu0EPhD9dt0VWh Lh ph`HR=jS MqS |EpS } h芯o[^_UWVS]S|Sx(qt,qpDžlDžh =ougSjj|Q jxSjtW jpPhļj v 5$qh phV1 󫉕`Dždlt2||`|| |Cdht7tt`d9t| tBdjjj`QdSd ,}8h@O#&dtXXTT\TX`ttxv|p؃`h\PSǃ} 8t։1ۃ)P\PV}tԃ tωH9uŋdd0lh h;|u h,;xu h;tu h@hͰ|RwxQh pSVtWGDžlDžh hļj s8[^_ÉU WVSEPt4P ǃ u h@lUR`4] )ÃShQ MQ>4SPW Sh&EP4)+Ep;UM UD  VPMQSh EP3SWUR3 W` MQ3e[^_UVShTjà uh4vShhSV Eh2VÃu!3'P3Vh@ɮ:5 &PSP# uVh荮[^ÍvUWVSu]=@v jt hn} u ]ߋE ] t&}u ߋE]t&}uDž @EEP}WE PWt[EPEPE PWVS EPEPE PWVSu‹!&1}WSEP} WV2[^_ÍvU= pt=$qt=@vu h,ÉUS qt!Ph j5 qu h]E CSjuՃh@謬]ÉUWS o= otcWsPhŸh˸hSGE0Wh߰эAPSu41[_US]} u S SS|S ]ÉUuÐUju uU WVSu1@5Hvh hSYh d SVE PSMQ!u[^_ÐU WVSu 1@5HvhChSh  SPVSEPu[^_ÉU WVSu 1@5HvhUhSYh d SVSEP"u[^_ÉU WVSu1@5HvhhSh  SPVE PSMQu[^_ÐU WVSu1@5HvhhSYh d SVEPM QSEPu [^_U WVSu1@5HvhhSh ܨ SHVEPMQE PSMQu  [^_U WVSu1@5Hvh`hSAh L SVE PSMQ u[^_U WVSu1@5HvhhSh ̧ S8VE PSMQu[^_USuhu ]E CS.jquՃh5]UWVS}th* _1҃x;_ s>t&t 2<%u2?uE\EVǦ1҃CB;_ r2xt V襦h*蕦X[^_ÉUVS]h*m1҃x;t22<%u2?uE\EV71҃CB;u2xt Vh*h[^ÍvUÍvUÍvU WVS]} uS)ǃWS)ƃtuWZ1e[^_U WVS}] uWt)ÃWf)ƃWG) 09s t t t@9r1e[^_ÐUS]M 9s t u@9r[ÐUS]ـ;tA9u[ÍvU WVS]} uS(ǃWSƃu1uWe[^_UEEE@PjjjjÍvUS]Sh@@jS ||PjS}Sh貣Sh]ÍvUS]SḥjS ||PjS}Sh@>&Shv]UVSuEVhLjEPjjVÃ0u =t&} 8_u1ۅ}Vh订"uVh@Vhޢ؍e[^ÐUVSuEVh财jEPjjV Ã0u=} P8_u1ۅ}Vh'uVh[t&Vh@F؍e[^É'U|WVSht/fEjlP}EP|jjj)à }YjjSƃu S)5jnWS}S `v؍x[^_ÐU WVS} WL%ƃjSE0h\u;W$PW%PE0h.ƃ W$9th@|1t&jPE0hthC1   ƁvVhKh1_EP$EvSPE0hFÃ~SPEP#)ރu[^_UWVS}E t tE E ]S #VS&! wVC#VSW u S"1dS"V t ftu1<;EtPh@t&VG=vPhe[^_U WVSEUz1t j^ƃ]Sǃ FpSFpS jS4 U Fp 9taWFpPh?EP]SǃjSU  uW$ ƃWEHe[^_ÐUWVSu }E>t12uhy1]S,!jS1 FpPS* FpSFpS uSjuS@! WSSSu ޅu Vd 1tVt ftuh`褜;vtPh轗E1ۍt&V/UC~VEe[^_U,WVS1EPEPu u vxt]Sj S uuSmuuS^ WSu SSuju S2dSMt ftuhr,t&tPh荖1uSG‹ESe[^_ÉUVSu] S PV t tpCpVLCpV= CpV+Cp,V CpV Cp V ZC p VC pV C pVC pV C pVuV(e[^ÐUWVS} E}u}tE]Sޅt&}tSV_s^PV sV<sV0 sV!s,V s VsV EPV2Et&}tSVEPWV vV1}t5}tjVEPV }tjVVVu`uV(1$t&V?ÃV  S<e[^_U,WVS} ]SޅuFjVGpPV0GpVGpVLHv V1}EPEPWjV uuVBu VVu[u V#1 V>ÃV  S;e[^_ÍvU=`vt ItPt&1Uh%t uÐUVSƅ|%j'É3CPC1e[^ÍvUS]CP:3< Sp]ÍvUVSu]SV~Su V1e[^ÐUjjuu uÍvU VS} u ]SVS SSuuSv1"SƃS\ Ve[^ÐU VS] uVitPV^uVr VVu"uV1&VÃV Se[^ÐUWVS1}u}t} tt ]SVS uSuS t5}tjSzEPS }tjSYSSu)u S1 S ƃS V e[^_ÐUEt&t $tfuh1PhÉ'U,WVSDžE8t DžR u h迎]SK2Vˆ|}~j|VS MApSUBp,S MAp SUBpS ]jEPURu܃S1=t>PSwF<>ujSbQSR jSXUBpPS=0MApSUBpS uSMQ(PSqƃ0jEPRQ7{EPPURPVQ50P1%󫍽|EPhhAU Rǃ }4P0PM Qh S1S;PSEPWGƃ S9tI00PE Ph 赐 SYW\ U R=1W@S+[^_ÍvUWVSUEװэqE~ UMEEFwVh@1hhAU RNǃ})0CPE Phȏ1hnWÃu10PU Rhp舏 W81[Ut#u@jjVEPUREp S9jjVUREPUrSE SEe[^_ÐU|WVS}EPWju}(0LPE Phю1`E u}v Wku]SVS VPW9t40PU Rh 豎 S1 wFE PhIS1t&U RhI蛎S11S>9uF vSS S jƃ FpS FpS }tjSUSx[^_ÍvU,WVSPEPj}5E0PU Rh MQuvEPt&]SWSFƃ WVUR9t@0PM Qh ӌ S#EP#C w1U RhI֌MQ EP 1۾vUR 39sC v݃MQ ÃEP UR j* @pMQ BpMQ }tjEP U jMQw PU Svǃu&E PSh膋UR ]SMQ?PSƃ0jEPWLWTtURPMQPVWXx0Wx1%EPKSj ƃ S\ ǃSQ 9uSA 9t*U:tM Qh蝊S BpSAp,Sv Bp S^ApSI pUSt jr uFMQVuE PhI UR# MQ ChS}tE09URQ1[^_ÉUWVS]} 1E.h7SVEu00:Ph9È Ss1RujjEP<ÃuhKވuitu_jeƃSFEf jvtlh%V1 Ot&tu2Gw*jƃSF E shɇUR&t St}tEPUtV t&Ph 贇e[^_ÉUlWVSu} jWÃ}1hEPSj}Wh 7&uEPEPWS&|EPEPVS S1e[^_ÐUlWVS}jWÃ} 1t&EPSj}WhlS1jEPWS=jjjS u-jU RjSÃ}t,t(W:UVjE PWSÉ؍e[^_ÐU WVS}h7E Pƃt&E<#|tv< trP@tZ< t< t⋅8tGPEPu,tU R`V,&VhSVVi1[^_U WVS}jW2Ã|&E PWSƃSp jÃE PWS Stjnà E PWSotRhWVn_=w7hhV^=wE PVSu S1[^_ÍvUVSUu ]Mu QSVR%| QSVRE2h蜃1e[^ÍvUVSu }u?jVÃ} 1)&uVS?ƃSt&1e[^Í&UWVS} WÍC}CVaE PW]ǃ9tVWh`)~E]jEPEPWEPEP  WjEP%EPe[^_ÉU WVS} ujEPl t h }WP}PUFwh`g}&VgCPWa ;EtVPh.}CЃ)PREPbVjS;Se[^_ÍvUVSuj]SVES ЍX vSh|V9sh|vVwu SP SVe[^ÉUSEPuÃ}t;}h!|E= vPh |u RSoS]ÐUSj]SufEfS %]ÍvUMU fEUjEPQÍvUSj]SulUC C C ‰Ћ]ÉUVSu] EE%ځ % ؉EjEPVe[^ÐUWVSj]Suu11C1҉1 C1҉1 C1҉1 C1 C1 C1 C1 ׉e[^_UWVE U1EE U1ME U1% E ME UuFE UNE U% E  NjVEPe^_ÍvUjEPuaEÍvUEU UjURPJU WVS}juVW]F F F ÃvSh`xt&CPƃSVW3} tE e[^_ÉU WVSu} ]EU% ‰ ‰UjEPVaSWVSe[^_ÍvU WVSu u hxэYEU% ‰ ‰UjEPEPSVEPe[^_Ðt&US]Ct!Pj3C3]ÐUS]ChZCCC ]ÉUE@@ ÉUUBR )‰ÉUEPÐUVSu ]SuSVPe[^U WVSu} vWh vF 9FuFF V ^9s F hvN9v%)RRPF)F F븐vSh`#vvS6m^낍e[^_ÍvUVS]uCS )9vRVhu&VPu se[^ÍvUSM] QA )9v huډQ]USU] J +B9v h ^u)ىJ ]U WVSu>^;^ sU;Ph\5 +VЃu ha thd5 C;^ rha5 e[^_Í&'U WVSDžPED1 PSDPMQ}450~Ph[y hN&Xf}uVEPSDQf} u DžPjjjhVPDP t hs} u V%Vh@xjjjh\SPDQ0tV`DžhDž`LPShf\P@u6V\QhwLO Va&1ҍH<\t9\= &DGt *\B*\u@1EdDžhv9EtPURh@QbB UR5vPpe[^_ÍvU WVS}_LS`ƃuWGxvUƍvEt!B9}ȉB9}ȉB 9}ȉC9rЉ vG$jww |e[^_U,WVSEph)a]S1Ҹ9}!{t,=@9} <uu 1jRM uE~$puE  EEEPEPv$Ã}!袨0PhitU|SjWjjSSEPWËllpp@hEPClPC0} u C8 WSe[^_ÉUVSuMEE^$ڃ}EPEPjjS }诧EhTEvhT=xtGj[jv@ v2$ jjv vP@PvhT =xtZj\Tjv詆 j蜆 xuDuP h;ІvjivO Voeӆe[^U @WVS}wSU  7Eh?SV }t u ~Pwwh@ S?t%whbRWd=xt'GLPwhwR vWds=oth?PSWtEt-PSW҃u+wh1RW@dPSGt%vhbeQVc=xt'Wvhw.QVct=xtI~,tC}t=E8 t5EPv萭uEЃ uCPZSW=xt ~e[^_U @WVS}O L3U _\SSPSPw ƃ w VwhP}裢 w whO_ SG ;vp11ۡ|v9I=xvƍt&t!B9}ȉB9}ȉB 9}ȉC9r VSp w U  h@SV贫w Vwh@N }腡 w wh`N_ trSG ;vuZ11ۡ|v9s7=xvƉt!B9}ȉB9}ȉB 9}ȉC9rӉ vVSG\P[^_ÐUWVSu} ]~8SWVUSWV =xSWV;N(ȃjEPQTÃ}68tu8 tpSvhlM>t$vhbTMV _ 6V3_V_ hhG&>u|Fuv9sft]j]cvk ZvhLdž =o=oDvuV&}rh .GuV}Ph  G蟞Å}h Ft&SKSVy } h Fe[^_ÐUS 1Iy=x0$<0G(ELE$E8EPFTH,  , Hv=x0tSh@BFt* x tShBShmv~ tutvh=BEPvÃx~%hNhPh Bhl E9v RPvh AS贛<PvhSBE)uSF\P Sve[^ÍvUVSuHx~(hbhPh_Ahk v|;|vr Sh xvuSh@A1ƅuShk=ot=ouh@KVP~4t9~ u3vh@F F

tShjNtF=xto7tx,t|t4h0@vЃ h @|xvh?dv~$hhPh{?hje[^ÐUWVS1Esƅ|;5|vr Vh xvuVh@?EE}tE8tVhi=x s xujssǃjgsE tt;uPЅtPt% t5t&tt$t& (7L^PVh;> t W }tEPt~%h hPh=hh EP9e[^_ÐUlWVSEUMfDžDž} u E uhvY=1эA=vh'=1Mϋ󫡜vE}MEVhj SPPSj踌 thVgFt jj QhSvv趎 thF<v vv軘ǃ}&70耎PhA< ljPjjW覑 u 0}+<0腍Phw; W辋hjhjhhjWWMQhÃ0hPClPplDžvuPhm:[^_ÍvU WVSE fE11;=|vsfxvtQ; uLhEPClPu0E9lu$VhhP:SS F;5|vre[^_U WVSu}E=vc~ h 4=xjPPh]l j?lhUl PGlleESh@9 lÃumh9ljOPk E P@lPk `levlÃt+uh8ShEc}t4E P蠒Ë v@f|ftA ve[^_U\WVSE fM1󫡜vEEPhj S.PPSMQև t#P胒PEPh 7v:Ct jj QhWssƉ th`V7s ss˓ƃ}M{u%A0芉Ph7 0ePh&7 vV uVhh2t&ssVm}Bst6PPPWh6 V2[u#PMQh:6vVg[^_ÉUWVS} 5vurEljE;5v};@tf9{uURPkuEE;v|ʅuUREPh`5PUR4e[^_UWVS1;5|v$xv8]ShTp苐߅|;5|vr Vh xvuVh@ 51ۃÅuVh4Ht&jhVh@.5jbXK sghh jlgGPgEPsg GPcgGPVg gF;5|ve[^_ÐUWVSEEE=UUup}1󫡜vE} ƒUEPhj ]SEPMQSj讃 G]Cƒt s sRǃ}1舆t ash3t&ssW=}];0脅PPhy3 W蹃{u?1;]}}4蛃C;]|E#EUEtFSMPSWPv$Wh  S PS{e[^Ð&UWVS}tE8u 1URqEǃEEtj,WfEtE?t&v=vtV3qt3;u1txt*URVhlW q1qӍ&EPVhz]tj,S5fUtޅt ;YEPh4Wpe[^_ÉU|WVSu]S4mэAPVShs SUURmM yu(=wth"wE xU E ;p s0Vh`4t&M UAЉǃ]Sd}%PjjWSj ߅uE 0ht&UZ\~69t2VSh VWEq uVSh`vjjMQjWj uE 0hdt&1EEEE}󫍥x[^_UH}tLÍvUVSuv=vt#V3,ou t&;u1e[^ÍvUUv=vt 9Pt 8u1ÍvUVSuu :*v=vtV3nt܃;u1ҸtBe[^ÐUUv=vt9Pu 8u1ҸtUWVS} u]u-=wthwvU ;w s7Vh`}t;_s7ShEGЉE]Sa} %PURjMQSYh ]u7h4t&EX\~69t2VSh 3VURn uVSh` jjujMQg u7h t&e[^_U WVS]M1vׅtQh CQuu SR@Ѓuha e[^_UEPhu h@ÐUE@ÐUE@ ÐUE@ÐUVS]u MBtt htSu^C@ tl9tQPhnh &zUuQVjCPj8C$QPVvj(jVjCPrhnhc ve[^ÐUVS]u At tSvt;uFCP tQyUuRVjCP9t&C$RVPi%jVjCPZqhh e[^UUxuB@ ÍvUSUM 1ۋ@=Lt=RuBX t SrdQOi؋]UU@=Lt=RuBp u rdiÍUW1 RS,4S_UEjuu p`cUEu uup`6ÍvUUE =t =t%R`EB ur`袽Ít&U WVS]M E}~L C C0 CCAAAAOEPE PPuwЉNjU ы]؅}C~Uv A A AABBBBKe[^_U WVSmkƉ ؏w؏Sȏ [^_ÍU WVS]sTt!u1҉AV_gCTe[^_ÍvUW1  VTU:_ÉUEMU@Tu h } tRQPet&RPQeÉUtnjj jV^ttuVhI]tj,StVUtޅt;uEP`e[^_ÉU,WVS xuE<]S覊EP`EE u썶]tj,SUttljhSH^tŃEP蕊tjhEP蟊߰эAPSEP}ut&jhEP]EP>P `ǃ0EP臉EP_ EPh'Wh" ?uh=t&e[^_ÉUhxÐUhxÐU WVS= xt] x1jװэAPREP u$ xEPh?xx<uEPhe[^_ÍUE PujAhU, WVSuDžEPhhUR!^ u Dž vŠH@< t< t担# ˄t t tCt< t< u)PE P rH@< t< tRV\f t u PъP tȀ tVs}t E}uM9t~>uyFtrpgV9t`SFpNVPE PRMQh q PURFpVPShC VMQ_uGDžPh RXQ=[%PhAR[1[^_ÐUVS]uEU EHM@< t< tRVdt1Et&E t uEPUъP tȀ tVq‹E e[^UEu h&>uujPu uWÐU WVS}uEu ~vh8W~ZÃu 1`t&u h:SQSVg tEt&Wh@RhnSMQSYEe[^_ÐUuuuju u%UE PujÍvUE PujuÍvUE PujYÍvUE Puj=ÍvUE Puj!ÍvUE PujÍvU WVSEM u1;xHw_$4=xuMv=xu<53' t&tBQRhhSX VShVP&t&VQhSP=xt!PhSP=xtW]ÍvU WVS}t4=yt+y1ۃW4Vuy<uܸe[^_ÍvU WVS}t==hyt4hy1ۍt&W4`Vu lyt&<u׸e[^_Ív'U WVS]} u ;%x<*uZGth}[ >0U=Ps$sh@H9CPX} =0=Pssh]Ð&UWVSy;yDžu1 PVR4@|\Dž1 PS5y?|&;uuEft f t1[^_UWDž|U1 |PR5yC|+Eftf u}u}u}u1hÉUWVSEE =xt]wVjSDEhԑ6mWShԑcme[^_ÍvU,WVSE=yhljhԑ[n jh.hmhhԑ肙 hԑlhlPhlPhԑl0hԑlx}P)E)EEE}}}}}}=@u9s16Wh^^Whl^PShK Whl>_}Uzh]Ph]P5EP6]ƃ hl]NjUJ 1t th'Ep hl^}t UPuh?Puf=x| hz1u h\[wSh[jh]Sh^ }tgExt^hM\hh軉 h+\h3\Ph9\Ph;\0hYÃu jzÍe[^_ÉUVSut&=xV.Ѓt tX6v!y j ÃShy S1j [ ƃj SVzdPh S0h Ph%t&Ѓ  t;i$u^jM ÃShy Sa0j ÃScPh Y hI%e[^ÐUS=xt x@E PuhS$(=xtLjvƅjPhԑZShԑXhQt&j$*ShԑX=xt cÉUS=zt h`|zE PuhSF'Sh =xt@jjhԑTShԑWhQjJShԑW=xt =yyy;yu jP( P$5y$ hlWh\W hԑWhW =ythW!h@h hUSy P,Ãh\WPh\WP5y#U&8 0%Phhy PjS.yЃjjSjy@Po$ u% tփtуh\V~ZPh\VP5y""%8 t)0$PhPh\W'S2,]ÐUu5yh h5yjhS =zzyF5y]E!t0t'5y}uPhtKtBjEPjj5y' }#]$0#Puh, =(kuj5yL%ÉUSf=x}1s1ہ=w^=wR0 , ,t 9w3u9 w)( $ $t9w u 9 v[USh謻Ãu h EyE yjjjjhQSh@g jjjjhQShI| =yuUyhlSh\S hԑShS]ÍvU5y^y;yt P^ÐUyÉUyÉU=yyy;yujP"t&P5y hlRh\R hԑ|RhoR =ythVR}h@艼h|ÉU WVS] }WƃuWhwSh vShzSEPh@T'`jjjSEPVh@10jjjSEPVhe[^_ÐUEt5`h@P&`UEyÍvUyÉU=yt=xu hRy=ytyh)Qus}}UyÉUEEjEPhԑaQÍvUuhԑLUuhԑIUuhԑ6JUu uhԑ?OÐUuhԑOUu uhԑPÐU=xtQÍvUjÉUS]j9tPSh]ÐUjPÉUu uhl3PÐUjEPhQEÐUhiKÍvUuhIUuhfJUS]hOthO]ÉUuh6MU}u@P艺ÍvU}u@uu PÐU}u@u P^U}u@u P~US}uE CS MQSE[U}uE EUAQ EAU50PÉU}u@u PUh\N~XPh\NP5y# t%PPhPh\OUh\M%ÐU=yuh\xM=h\_M=?%Uh=MÍvU WVS}1 =xtPvWhԑH19}/u肋ƉEjEPhԑLC9|эe[^_ÐUEyÍvUS]= ztS5yheD=vShA  zSh Zy؋]ÐUE4Ít&'UWVSu5t 0Ph u hS߅}$0PhV1f}$Q0Ph#1# P P# jwq }0(Ph.ju VVp0PVhDs11)P7Pp#Ãu Q8t~ ߁u7jQP} 8t׋ut1M&1Ҁt B<2t2 t u2V‰1Ѝ[^_ÍvU WVS}1=,k=(k=0k] E tj ,jhaZ|PtThjt@hrthr WPShSW詚߅E t1huW5I51 t&)P>Pj6!Ãu 8t~ށt<> tD7h55 WÃhjxW'؍[^_Í&'U WVSEpE~UBx~uh 葾EpP}PURyǃ U RP}PVPà SE PJjURWSV0 hS uPWxEPjW&VjSW{Sre[^_ÉUWVS] Ep.P}PURE SP}PWrƃ VSojEPEPVWÃ0ho&uSEPEPjEP7WjV(EPV؍e[^_ÉU WVS}CÅuh褼t&7ƅu h舼<Pw SVSww(j0PwSVSww$j0S=Ve[^_U|WVSE8~tP:Ej/MQEt+u}эquu I9cvh覻]VMQS{S uEPhj}u5*=ҋuFэD X~h@Ph SǃVuBtQRhSWx[^_ÍUE wWw&w  =wt&==t&12K}nvng^,WXNG>` 7.K'%ÐUE=>u= /2 `KnI==,=,=X=K3=` ====v==t&1}vng^WN G > 7 .' ÐUlWVSu ]S(@=xtEEElEEEXu$]Su &}]ăSP`ƃ Vh9EPMQ= VEP;S] Pƃ0VhMQEPP= VMQT;EPjh jEP=EPMQEЃ EPjh臻jMQ< EPEPMуEPjhQ jEP<EPMQEЃ EPjhjMQv< EPEPMуEPjh jEP=<EPMQEЃ EPjh詺jMQ< EPEPMуEPjhs jEP;EPMQEЃ EPjh:jMQ; EPEPMуEPj h j EP_;EPMQEЃ EPj h˹j MQ); EPEPMуEPj h蕹 j EP:EPMQEЃ EPj h\j MQ: EPEPMуEPjh& jEP:EPMQEЃ EPjhjMQK: EPEPMуEPjh貸 jEP :EPMQEЃ EPjhojMQ9 EPEPMуEPj h/ j EP9EPMQEЃ EPj!hj!MQJ9 EPEPMуEPj"h謷 j"EP9EPMQEЃ EPj#hij#MQ8 EPEPMуEPj$h) j$EP8EPMQEЃ E Pj%hj%MQD8 E PEPMуE Pj&h覶 j&EP8E PMQEЃ E Pj'hcj'MQ7 E PEPMуE Pj(h# j(EP~7E PMQEЃ E Pj)hj)MQ>7 E PEPMуEЃPj2h裵 j2EP6EЃPMQEЃ EPj3hdj3MQ6 EPEPMуEPj4h% j4EP6EPMQEЃ EPj5hj5MQ@6 EPEPMуEPj6h袴 j6EP5EPMQEЃ EPj7h_j7MQ5 EPEPMуEPj8h j8EPz5EPMQEЃ EPj9hܳj9MQ:5 EPEPMуEPj:h蜳 j:EP4EPMQEЃ EPj;hYj;MQ4 EPEPMуE Pjh薲 j>EP3EPMQEЃ EȃPjFhVjFMQ3 EȃPEPMуEPjGh jGEPu3EPMQEЃ EPjHhرjHMQ63 EPEPMуEPjIh蘱 jIEP2EPMQEЃ EPjJhUjJMQ2 EPEPMуEPjKh jKEPp2EPMQEЃ EPjZhҰjZ]S02 EPSMуE0%Pj[h菰j[S1 E0%PSEЃEPj\hR j\S1EPSMу E Pj]hj]Sv1 E PSEЃjMQO1=xt+EPx3PMQ3Pr)t&EPM3PMQT3P{ EP2e[^_ULWVS1E=xt9U Ph=E 8Et&E]SUR uEFÁ$ÃSh®}tăS)PEPS uShTt&HÃSh6t}rSPUR PShQ諭:vU҈EՃEPj&U҈EփEPj&U҈E׃EPj&U҈E؃EPj&U҈EكEPj&U҈EEPjb&U҈EEPjB&U҈E݃EPj"&U҈EރEPj &U҈E߃EPj &U҈EEPj &U҈EEPj &U҈EEPj&U҈EEPjb&U҅tMePj;U҅tMePjU҅tMePj U҅tM e߃Pj!U҅tM@eĿPj"U҅tMĀePj#U҅tMePj${U҅tMePj%[U҅tMePj&;U҅tMePj'U҅tMePj(U҅tM e߃Pj)U҅tMePj2U҅tMePj3U҅tMePj4{U҅tMePj5[U҅tMePj6;U҅tM e߃Pj7U҅tM@eпPj8U҅tMЀePj9U҅tMePj:U҅tMрePj;U҅tMePj<{U҅tMePj=[U҅tM@eѿPj>;U҅tMePjFU҅tMePjGU҅tMePjHU҅tMePjIU҅tMePjJU҅tM e߃PjK~vU҅tM e߃PjZ^vU҅tM0eσPj[>vU҅tMePj\vU҅tMePj]hk vSSh赧=xu%C~w FwCvC=w nSh'E 90t0VVh  =}t7URjEPu0(Ph`ͦe[^_É'US]uh!աt&SuSh !財]ÍvUSE] u hN!芡u SY SPuSh!\]ÍvUEu h!:P-ÍvU WVSuӅu h!SǃuSh !ߠSVW贀e[^_Ív'U WVS}1vI)PEPE PU҉Ãt t&Gt t9we[^_Ít&'UVS]jKƉFF Ftr~Åu h"qCuh"џWCuh"跟&^?Åu h"萟C uh"w&Cuh"W&Cuh"7&Cuh"&^ 6h#e[^ÍvUSuÃG‹CPuh #袞'‹CP,uh #肞‹CP uh #b‹CPuh #B‹CP(uh #"‹CP$u/h #‹C Puh #؋]ÐU WVSu] t t;t 1t&~ tN1VCprCpFpq&1V tnC tgp r >uRC pF p#u7C pF puC pF pt&6hY#e[^_U,WVS]E EEUtu &Ph#bt&CpB}BCpP}P2E PEPCp EPCp6EPEPS' 1v3h#聛}t\j@ƃW]S uuSEPVS ujujuh$e[^_ÉULWVSEaEeEiEoEuEy}($EE @E܃@PExE]9]PuuЋE@E̋U9r M ]u^]ȈMء<$R)ÃUȃ֋E%<$֡<$UčR)ƋUЊMԈGD+GG]9]uELp%D(UԈG-GD)G]؍ Ep)؋U\r98)M1E%<$RM)]ЊuԈ7GE7G7GẺEU9MxD9Eԍe[^_ÍvU,WVS]1EPu uTEuh@$t&t tw]EDPE19s;}UTUUPh"$jWEPWURw F9rҍ[UD}$uEP]ǃSh$LujURwEPe[^_ÉUWVSE 0Ut< 1҉TBF< vE 0UB@EC< t< t< rE ЍU< w C< v3E 0RH:E UB@EE t&C< t< t< U ЍU< w C< v3E 0RE j VÅuh$t&VE }uh%ěks{uh%褛KUt;Eth3%~%UEэMS"ǃSWV$ }!VhK%蠚WPWÃWt uVh%cU9h%At)~tP>|:Ct PC.C t PC 3h?#1S E8u%@t PQCUBC&UB t PyC UB C t.~ tWEt&|Fp_Ph&WF poÃuh$M1&Sh$W=S t\FpÃuh$1!Sh$WSd t Eh&賗u~ u uy~tsEPEPV]EPà UPSRua!~#SV Ph$&WMEu(SEe[^_UVSu~njÃF p C p F pC pF pC p F pC pHPÃFpCp FpCpv6h`'虑؍e[^U WVS]ؿ'u1PuCPuCPuStCAuCu CuCu [ؿ?&u 9t&ؿG&tSh' e[^_ÍvU WVS}tE8u 1EPXEƃ}tj,VvEtEtT>tOPtu V1L]tj,S't؅t;uEPh'+Ve[^_ÐUWVS}u E]SNVWS jSeƃV tP tjE@pS UBpSxjE@ p S UB pSUB pS UB pSjEVh'rS}ttPh (KV;SEe[^_ÍvUWVSuuhN( 13t&]S߃tXhG&WF p WB F pW0F pW! F p,vh?&WFpW FpWPh(NW1pWsÃ}tE} t*SxƋE 0WX SPV6W>SjPkW؍e[^_ÐUVSujËFCC Cl~~YCu h)谌Fpn‹CPuh)膌Fp>‹CPh)RC uh5)7&F p ‹C P uh)F p‹C Puh)֋F p‹C Puh)見F p^‹C Pu#h)v6h?#a؍e[^ÍvUS]t)~tM<|8Ct PrC+C t PC 3h?#S]ÐUEtt "tt&*&/&3&7&ÉUU|1~ t%t&BpB p 1U WVS}] jƃ~VxjjjjjjSà u h&S u h&^ ;jjj#Su h`&軉FWh@'袉>e[^_UEtt ?&G&O&ÐU WVSU} u]Mtu$QSVWR!(t&QSVWR%Ph(e[^_ÐU WVSM} Uu]uDtu$SVRWQ"(t&SVRWQ'Ph(Re[^_Ðt&UM1v @=vÍvUU EUSU ]E9w=w@9w=v[ÐU WVSu }]}uS_ƒt&Sƒt;B=wt WuRRhI*#t>te[^_ÍvUS] Suh)Y=xuh*tt&j躢S 衿\]ÍvUu uh *Í'UWVSuj(ǃ]S VPVPS SO Ny1jS| Ph*Ë F ~ۃS ƃ} tE 0Vh+蓋S ƃ Vh@+wSe[^_U WVS1}uh@,֊E@Hthg,t&UBDӃ$S߃wh,хWE1ۃu9MƉUC~jWxPWP詽0载h,hEHHe[^_ÐU WVSjlQE1E4P u$V V jV Ky1ۃE4V C ~jVo jVx MADQbhxj1j6h@jEe[^_U WVS]} ujVW&uVWh.Dt&ƿ,.u 5t&ƿ1.u t&Ph6.Ce[^_ÐU WVS]juu 蔏CuhJ.豃ƿU.u C Tt&ƿp.u C 4t&ƿ.#u C t&Ph.Be[^_U WVS}u z=ztjj,4tj,4t44%t44h/݇1;uh!/će[^_ÍvUy]ÐUu uh`+}Í'U WVS}=ztn$z1ۍt&zE P*u;t"FЉG@G Gt }G E Ph0}1% zuE Ph0}e[^_ÍvU WVS}tE8u1EPEƃ}tj,V4EtEtU>tPSj|_EPSh1%}]tj,Stt;uEPh(1|VOEPSh1|V-1e[^_ÍvUVSEu Pu h0Owx @v h0tsou 05Psh32 t]ÉU=xzuhF2xv=|zu h2s5tz5pzh2x5pz }#]0P5pzh32ys5tz}$%0nP5tzh 2As5z5z}0/Ph2s|zU WVS]`ƃ=|zt h2rs sh3wC PPP' }$e0Ps h.3rt&CPPP} ,0uPshC3Kr;s t:{t4V3uVBthX3h3 r;C u ;C t(s PcPhX3h3q&;{t;W.uWthX3h4q&W;Cu ;Ct!sP7PhX3h@4[qe[^_ÍvUuuu u):ÍvUVSuƉ B< t< tvBt< t< uuu V;ÃV؍e[^ÍvU WVSu6SǃSWVE P9ƃ19}Gt&;Ph4MQ6F؉љEuh4EPC9|F؉֙Eth4EPWe[^_Í&UVS]EEPuVjjS u"0Ph`6t}uSh6tSh6t[ESh6tSh7|t jVjjS u0gPh@7se[^ÐU WVS]13u1bh_7VtI8=uhe7@PG‹D8=uuhe7@P"@e[^_ÉU WVS]jƃ13WsJF s9FCFC F sF sFe[^_ÐUWVS]Eޅ>EEt&jj EPVÃ}98"uEEe[^_U WVS}EPu hSw?u Gt&G9rP7wSHW GW[^_UMȀ9tv t u@8uÐUVSujjVÃ}%0 PVh[5p^uIVh5pSjVà u0s0PVh5pVhu5p1e[^ÐUVSujjV<Ã}'0aPVh[5obtKVh5!pSjVà u20PVh 6oVh5p1e[^ÐUVS]EjjPSU9t#:u>"u=t=t ~=~1e[^ÍvUWSU:[u/Ӊ߰р| ]uшD Bv[_ÉUE1Ɋ:u M&@E[ut5@u x[u]u x:uu΀:ut /t@8u1ÍULWVSu] EEEĉ1҉UԉUEEBBZ EӉEȍUBUEjMQVu#0PPSh7h7#ivtPh7h 8ie[^_U@WSU]1EӉEȍE@EEMԉMEjSR?u"l0赿PhE8hS8htPhE8h8qh1} vEuhE8h8OhPtRjhE8h85ht&@ e[_ÍUWVS}t ?u uh?9lP]S/uuS0 tPuVS w tVà j@jdVuhX9%l3P}PpsϿP}P pwv(VpPhr9kS#Ml1 p싅l)P3V؋l)Psϻ SCxt=}t E(} j(NjM 9l xVh9V j(lPVVà }tM} t*SNjE 8V SPWV:1X[^_ÐU|WVS}7E}tE8ux uh9Gj?xt$WƃWE PVW} ]SWu VSV jSE9ǹ1t ߅t3EPh9iWY uVEPEPSƃ SǃS t'Wh:IiV<8E(tPh@:jdaDžuh:Rdu h:8dGu h:d7jV莸wjFP} ujV,VuV]S0 uuS.EPuVS Ep WuV誾Ãj@jdVWt:u: t&:Ph:Th؍x[^_ÍvU|WVS}tE8uxuh_;gE@ x tEURrPL uEPh;xgP]S uuS EPuVSUrǃ WEEpEPURuVEP͹Ã0j@jdV{t7jP@Ph;f URE9r)vaPWh<fEP)ÃPWh;fuEPP SjUR]S"h<SD WURSSNE }tU} t.uPƋE 0S0 uPV StWjsUR>EP蟿1x[^_ÉU|WVS}tE8u@uh'<iep0=1hUBp Ph`<#eU]Suu S^ jSE<ǹ1t ߅t3EPh<dWa UR螾uV舾EPSǃ SƃS t!Vh<QdWDzEpËE9v$SPh =dW>9sG)ƃPSh`==dSW臽ǃ uW>PVVjWG]E@ x tEURkPE u$uVh=qcWdP]SuuS EPuVSڲEpuWuVUR\Ã0j@jdV莾ujsW}W=u=Ph=c؍x[^_ÐUWVSEu}EEt#@E>Et&E>EE9Et h%>W۾t9vh1>&PwEjWRuV莵ƒ0})jPRPh<>a aE9t SEPRh`>4u}t h>uދ} Mth>aE}t UR_Ee[^_Ð&U,WVSUB t t&/&&Ep h>h?H\UBPWjw wdh#?a h@?`jq EP^EuPE u h`?[UBU9th?[UBTu h?[URЃu h@k[Euh$@R[EPtEP贔E ɖ~)jch:@Ph`@_h@n &URWuh@CW菲EP׸à WEPS 9Euh@ZURVSEPjS謺SUREPwuUR]4S,PS3P]$S PSPEpPpL!Ã@UR蜸EP WTjSuUREP0t hAYURMEPA U:u&Bj艷UrSPS EPSUREPS URe[^_UXSe輹ƃu hDBXVA襓~%jVhKBPh`B\hBJ vSc=|SP= ~!h S8PhhBWSV{ǃUBPW hBn\j r w6虏h CD\ j!賏EP裐E uP=Eu h`CVUBU9thCVt&UBTu hCVURЃu hDV2Euh$DVEP贏EPE ~)hhKBPh`B [hB諅 t&URWOuh:D胅WϭEPà WEPS`yEuhUDUURVS>EPjSSP x@t EU܉U؋EPURww wEPUREPuUR]4SDPSKP]$S$PS+PEpPpLyÃ@W臲UR諳 EPjSuUREP0thDTt&UR`EPT U:u&Bj蜲UrSPf EPSUREPf URe[^_ÍvUWVSu EPǃPhEOY WEEUE]jEPEPhth.EtX?WEPPEPh޲9th.E:Xv1e[^_ÉU WVS} hBEXjuVEPh臲 ttPh`EWv]F F F ÁvShEWVt&WSW SWPEPh9tPhEIW1e[^_ÍU,WVS}EEhFWuhFCRvEPjj,ju tdw<$Ht&z.z'zzzzFPhFVEtU ph Gt&ph`GVUMu]t t vE Et&:tSjW葴1u(hGUuL"ExtE1@t1EE~DUVUEt%PŮEFURPEP芮 EuhGdU2&U8Uu#E8EuM;Muu}uU CE;XLRi!Ut"th HUh`HU hHT1e[^_UWVS}EEEUMEE]u ttE&E:t"SjE PȲUu1}t!EPEPEPj,EPhHEPEPURhHWͤ 1;]s&&EPhIW覤C;]rhIW菤E h ImSEe[^_ÉUQthINvÉU蝧5Ot艧PhOhI]NÍt&'UWVSu1;} 1Љ 111ÁN1ʉ1‰ 1‰1%FNV t2t At-u7 %VЉF'&  É^ HFF~tU2%{Uz2FUG;} 1[^_ÐUVS]E MS@CCCtKEC C(1ҍs Kv |2B~S C €SC ŠKȃ ‰%  SC[^ÐUWVS]E S@CC(1ҍ{ sK&22 %|:B~S C €SC ŠKȃ ‰%  SC[^_É'U=Ȯt"Ԯ1҉EUmȮEUm$Ԯ1RPȮRPhKP =t"1҉EUmEUm$1RPRPh@K[P =}u=}uha=}u=}u hÐUS]=}uhܬ}ShJOCvShJJj8hJSh薤]ÐU=}uh贫}j8hJhcÐUVS]u S6S6SĮ ̮Юjh距u+ЮPSV}PhKI=Юt[^ÐUVS]u SSp  jhMt9u+PSV?}PhKI[^ÍUWVS}] 119s!L&29%3A9r[^_Ít&U,WVS}1҅t?uu0EjEPƒUjEPtƒ] M9sru߹u&UjEP;ƒUjE!UjEPƒUjEPƒE E9r%e[^_ÉUWVS} wE tU RhaPG}E @ڋ }M9s9r}u)hPzLPz}} "9vPEP螥}}} 8UU] CE;Es1uǹuMQE PURMQ-QE9]m}tu}uEPU RMQEP3}Ph5}輦}U}t2MA A A ¡}H!‹EfPUUEE 9MA A A Ë}B!á}EMYuM<CB!ËMYft;fuՋu}uՋEPU RMQEPt$}UfXEEEE 9EH1e[^_Í&'U WVSE }E]S8u St t<#u1]j SEtE؋]8j SƘEtE؋]8j S蕘EtEug;^j VfEtE}9>0jj jV7@]tj SEtEu;j VEtE}>>Gu hQC%GuhQCt&SGPOtLVGP;t8wٛ;u&WBtu 8uz t .vw!w uh@QG1e[^_ÐU,WVShaQhcQZǃu7haQhyQ?ǃuhcQhQdG/1DžDžCPVS tuRD ;EK;E|F;E ~;|;~!E 9}Dž;uWhV,XW訙u(WßhyQhQaF )1 1[PVStB;E;E|;u C;t53% WhVcuW@9thyQPh R@[^_ÐUWVSu EUBuhR@?6P]9|#6PEp٘PhR?@UBt P8谡UBu h S @jjURP蛓u h&S?EP苗u hAS?11}GSUrtFCEp&9~ӃUrPVh`SD E} ~ hS[?EpVؗE~ th`RC1v19}SV[tEC9~Ur{PEPhRD }~UrVԠt-Ep;PURhRlC1 Te[^_ÍvUS舗Åu hSi>u CP6uhSF>uC P u hS>؋]ÉU…uhS=E BEB U WVS=}5}ҖÅuhS=vVCPu hS=WC P^u hSn=؍e[^_U WVS=}5}VÅuhS7=&VCPu hS=WC Pޔu hS<؍e[^_U WVSE P[1E x th`R~A119t&SE PߘtGC9~EpPWhRA ~!EpE P[uEp軔PWhR@1e[^_ÐUE= t&=~ É'U,WVSu} HE܃]SUVS{ WSnE@PST jS2EPEPS E@PS$jS EPEPSYE$PE PS E(PSXE,PSK E0PS;EPuVW SPSPVD jhV!Se[^_ÍvU,WVSu}E܃]SVS; E PS+GPS jSWEPSJ E@PSjS EPEPSE$PE PSM ރ}(t}0uE,#E(PV菾E,PV肾 E0PVru4V׻u8V˻ uPVHPS誕 jhS臍Ve[^_Ðt&UWVS@1j]S膕ޅ腗PhX8Vjh@ t&SSjh@y1}e[^_UE=}=}t}9EPPjh@脑}EÍUEE URURjjP|UE UE1vÉ'U,WVSuPjV蛋tbE 9tQt1#xP觖EuE E tjSVu t1u t$ t 203 NXSSH running with pid: %dsetrlimit failed: %.100sYou don't exist, go away!HOMEWarning: $HOME directory '%s' does not exist. 1246ab:c:e:fgi:kl:m:no:p:qstvxACD:F:I:L:MNP:R:S:TVXYBEWarning: Identity file %s does not exist. Too many identity files specified (max %d)no support for smartcards. OpenSSH_3.9p1%s, %s noneBad escape character '%s'. Unknown cipher type '%s' 3des-cbcblowfish-cbcUnknown mac type '%s' Bad port '%s' %5[0123456789]:%255[^:]:%5[0123456789]%5[0123456789]/%255[^/]/%5[0123456789]Bad forwarding specification '%s' Bad forwarding port(s) '%s' Bad dynamic port '%s' sockscommand-line%255[^:]:%5[0123456789]Bad web proxy specification '%s' Bad web proxy port '%s' NX> 285 Enabling check on switch commandNX> 285 Enabling skip of SSH config filesNX> 285 Setting the preferred NX optionsDISPLAYYou must specify a subsystem to invoke. Cannot fork into background without a command to execute.Pseudo-terminal will not be allocated because stdin is not a terminal.Can't open user config file %.100s: %.100s.ssh/config%.100s/%.100s/usr/local/etc/ssh_config/usr/local/etc/ssh_host_key/usr/local/etc/ssh_host_dsa_key/usr/local/etc/ssh_host_rsa_key/.ssh%.100s%s%.100sCould not create directory '%.200s'.clear hostkey %d`` ``````````  @e``D```t`&```p```````V`0``G:````PNo xauth program.x11_get_proto: DISPLAY not setlocalhost:unix:%s/tmp/ssh-XXXXXXXXXX%s/xauthfile%s -f %s generate %s MIT-MAGIC-COOKIE-1 untrusted timeout 1200 2>/dev/nullx11_get_proto: %s-f %s %s%s list %s . 2>/dev/null%*s %511s %511sWarning: No xauth data; using fake authentication data for X11 forwarding.MIT-MAGIC-COOKIE-1%02xConnections to local port %d forwarded to remote address %.200s:%dCould not request local forwarding.Connections to remote port %d forwarded to local address %.200s:%dRequesting compression at level %d.Compression level must be from 1 (fast) to 9 (slow, best).Warning: Remote host refused compression.Protocol error waiting for compression response.Requesting pty.TERMWarning: Remote host failed or refused to allocate a pseudo tty.Protocol error waiting for pty request response.Requesting X11 forwarding with authentication spoofing.Warning: Remote host denied X11 forwarding.Protocol error waiting for X11 forwardingRequesting authentication agent forwarding.ssh.cPacket integrity error (%d bytes remaining) at %s:%dPacket integrity error.Warning: Remote host denied authentication agent forwarding.daemon() failed: %.200sSending command: %.*sRequesting shell.Request for subsystem '%.*s' failed on channel %dsuccessfailureremote forward %s for: listen %d, connect %s:%dWarning: remote port forwarding failed for listen port %dControlPath too longssh_control_listener%s socket(): %s ControlSocket %s already exists%s bind(): %s %s listen(): %s auth-agent-req@openssh.com/dev/nulldup() in/out/err failedclient-sessionsessionssh_session2_open: channel_new: %didentity file %s type %dcontrol_client%s socket(): %sCouldn't connect to %s: %s%s: msg_recv%s: wrong versionConnection to master denied%s: msg_send%s: master returned errorReceived EOF from masterReceived exit status from master %d%s: read %sExiting on signal %dConnection to master closed. @V`V@(#)$OpenBSD: readconf.c,v 1.134 2004/07/11 17:48:47 deraadt Exp $controlmastercontrolpathsendenvserveralivecountmaxserveraliveintervaladdressfamilyconnecttimeoutrekeylimitnohostauthenticationforlocalhostverifyhostkeydnsenablesshkeysignclearallforwardingssmartcarddevicebindaddresshostkeyalgorithmspreferredauthenticationsdynamicforwardloglevelnumberofpasswordpromptskeepalivetcpkeepalivecompressionlevelcompressiononlycheckhostkeyaddstricthostkeycheckingcheckhostipbatchmodeconnectionattemptsuserknownhostsfile2globalknownhostsfile2userknownhostsfileglobalknownhostsfileescapecharhostuserlocalforwardremoteforwardprotocolmacscipherscipherportproxycommandhostkeyaliashostnameidentitiesonlyidentityfile2identityfileusershfallbacktorshgssapidelegatecredentialsgssapiauthenticationafstokenpassingkerberostgtpassingkerberosauthenticationtisauthenticationskeyauthenticationchallengeresponseauthenticationhostbasedauthenticationrhostsrsaauthenticationdsaauthenticationpubkeyauthenticationrsaauthenticationkbdinteractivedeviceskbdinteractiveauthenticationpasswordauthenticationrhostsauthenticationuseprivilegedportgatewayportsxauthlocationforwardx11trustedforwardx11forwardagentPrivileged ports can only be forwarded by root.Too many local forwards (max %d).Too many remote forwards (max %d).%s: line %d: Bad configuration option: %s %s line %d: missing time value.%s line %d: invalid time value.%.200s line %d: Missing yes/no argument.yestruenofalse%.200s line %d: Bad yes/no argument.%.200s line %d: Missing yes/no/ask argument.ask%.200s line %d: Bad yes/no/ask argument.%.200s line %d: Missing argument.%.200s line %d: Bad number.%.200s line %d: Too many identity files specified (max %d). =%.200s line %d: Bad cipher '%s'.%.200s line %d: Bad SSH2 cipher spec '%s'.%.200s line %d: Bad SSH2 Mac spec '%s'.%.200s line %d: Bad protocol 2 host key algorithms '%s'.%.200s line %d: Bad protocol spec '%s'.%.200s line %d: unsupported log level '%s'%.200s line %d: Missing port argument.%.200s line %d: Bad listen port.%.200s line %d: Missing second argument.%255[^:]:%5[0-9]%255[^/]/%5[0-9]%.200s line %d: Bad forwarding specification.%.200s line %d: Bad forwarding port.%.200s line %d: Badly formatted port number.socksApplying options for %.100snone%.200s line %d: Bad escape character.inetinet6anyUnsupported AddressFamily "%s"%s line %d: Invalid environment name.%s line %d: too many send env.%s line %d: Deprecated option "%s"%s line %d: Unsupported option "%s"process_config_line: Unimplemented opcode %d%.200s line %d: garbage at end of line; "%.200s".26APp@pH @a @xvv`wA 00V 0 rfstat %s: %sBad owner or permissions on %sReading configuration data %.200s%s: terminating, %d bad configuration options/usr/bin/X11/xauth.ssh/identity~/%.100s.ssh/id_rsa.ssh/id_dsa/usr/local/etc/ssh_known_hosts~/.ssh/known_hosts/usr/local/etc/ssh_known_hosts2~/.ssh/known_hosts2ee@(#)$OpenBSD: clientloop.c,v 1.130 2004/08/11 21:43:04 avsm Exp $Sending eof.client_check_window_change: changedTimeout, server not responding.keepalive@openssh.comselect: %s Connection to %.300s closed by remote host. Read from remote host %.300s: %.100s clientloop.cPacket integrity error (%d bytes remaining) at %s:%dPacket integrity error.client_subsystem_reply%s: no channel for id %dRequest suceeded on channel %dRequest failed on channel %dclient_extra_session2_setup%s: cctx == NULLclient_process_control%s accept: %s%s getpeereid failed: %scontrol mode uid mismatch: peer euid %u != uid %uAllow shared connection to %s? yes%s: client msg_send failedRefused control connection%s: client msg_recv failed%s: wrong client version %d%s: receiving %d env vars%s: accepted tty %d, subsys %d, cmd %s%s: got fds stdin %d, stdout %d, stderr %d%s: tcgetattr: %sclient-sessionsession%s: channel_new: %d ssh> Commands: -Lport:host:hostport Request local forward -Rport:host:hostport Request remote forward -KRhostport Cancel remote forwardInvalid command. %s ENDNot supported.Not supported for SSH protocol version 1.%5[0-9]Bad forwarding specification.Bad forwarding port(s).%5[0-9]:%255[^:]:%5[0-9]%5[0-9]/%255[^/]/%5[0-9]Port forwarding failed.Forwarding port.%c. %c^Z [suspend ssh] %cB breakServer does not support re-keying%c& [backgrounded] fork: %.100s%c? Supported escape sequences: %c. - terminate connection %cB - send a BREAK to the remote system %cC - open a command line %cR - Request rekey (SSH protocol 2 only) %c^Z - suspend ssh %c# - list forwarded connections %c& - background ssh (when waiting for connections to terminate) %c? - this message %c%c - send the escape character by typing it twice (Note that escapes are only recognized immediately after newline.) %c# `Dread: %.100s write stdout: %.50s Entering interactive session.rekeying in progressneed rekeyingKilled by signal %d.Connection to %.64s closed. Write failed flushing stdout buffer.Write failed flushing stderr buffer.Transferred: stdin %lu, stdout %lu, stderr %lu bytes in %.1f secondsBytes per second: stdin %.1f, stdout %.1f, stderr %.1fExit status %d.Aauthentication agent connectionForwarding authentication connection.client_request_forwarded_tcpip: listen %s port %d, originator %s port %dforwarded-tcpipWarning: ssh server tried X11 forwarding.Warning: this is probably a break in attempt by a malicious server.buggy server: x11 request w/o originator_portclient_request_x11: request from %s %dx11Warning: ssh server tried agent forwarding.client_input_channel_open: ctype %s rchan %d win %d max %dauth-agent@openssh.comconfirm %sfailure %sopen failedclient_input_channel_req: channel %d rtype %s reply %dclient_input_channel_req: request for channel -1client_input_channel_req: channel %d: unknown channelexit-statusclient_input_channel_req: unexpected channel %dclient_input_global_request: rtype %s want_reply %dclient_session2_setup%s: id %dpty-reqSending environment.Ignored env %sSending env %s = %senvSending subsystem: %.*ssubsystemSending command: %.*sexecshellv v@(#)$OpenBSD: sshtty.c,v 1.6 2004/05/08 00:01:37 deraadt Exp $tcsetattrtcgetattrvv@(#)$OpenBSD: sshconnect.c,v 1.158 2004/06/21 17:36:31 avsm Exp $sockaddr_ntop: getnameinfo NI_NUMERICHOST failed%huexec %Could not create pipes to communicate with the proxy: %.100sExecuting proxy command: %.500sdup2 stdindup2 stdout/bin/sh-cfork failed: %.100srresvport: af=%d %.100sAllocated local port %d.socket: %.100s0getaddrinfo: %s: %sbind: %s: %sselect: %sgetsockopt: %sBogus return (%d) from select()ssh_webproxy_connect: needpriv %dtcpssh%uNX> 207 %s: %.100s: %s %s: %.100s: %sNX> 207 %s: %.100s: %sTrying again...ssh_connect: getnameinfo failedConnecting to web proxy %.200s [%.100s] port %s.NX> 207 nxssh: connect to address %s port %s: %s NX> 207 nxssh: connect to address %s port %s: %sconnect to address %s port %s: %sNX> 200 Connected to web proxy at address: %.200s on port: %.200sssh: connect to host %s port %s: %sConnection to web proxy established.setsockopt SO_KEEPALIVE: %.100s []:ssh_webproxy_connect: invalid hostname %.100sCONNECT [%s]:%u HTTP/1.0 CONNECT %s:%u HTTP/1.0 ssh_webproxy_connect: hostname too long %.100sssh_webproxy_connect: write %.100sweb proxy handshaking: read: %.100sweb proxy handshaking: Connection closed by remote hostssh_webproxy_connect: read %.100sHTTP/1.0 200 web proxy handshaking: proxy error: %.100sssh_connect: needpriv %dConnecting to %.200s [%.100s] port %s.NX> 200 Connected to address: %.200s on port: %.200sConnection established.ssh_exchange_identification: read: %.100sssh_exchange_identification: Connection closed by remote hostSSH-ssh_exchange_identification: %sSSH-%d.%d-%[^ ] Bad remote protocol version identification: '%.100s'Remote protocol version %d.%d, remote software version %.100sRemote machine has too old SSH software version.Agent forwarding disabled for protocol 1.3Protocol major versions differ: %d vs. %dOpenSSH_3.9p1SSH-%d.%d-%.100s write: %.100sLocal version string %.100sPlease type 'yes' or 'no': noyesForcing accepting of host key for loopback/localhost.check_host_key: getnameinfo failedusing hostkeyalias: %sHost '%.200s' is known and matches the %s host key.Found key in %s:%d%s host key for IP address '%.128s' not in list of known hosts.Failed to add the %s host key for IP address '%.128s' to the list of known hosts (%.30s).Warning: Permanently added the %s host key for IP address '%.128s' to the list of known hosts.:Host %.200s is added to know hostsNo %s host key is known for %.200s and you have requested strict checking. but keys of different type are already known for this host..Matching host key fingerprint found in DNS. No matching host key fingerprint found in DNS. NX> 211 The authenticity of host '%.200s (%s)' can't be established%s %s key fingerprint is %s. %sAre you sure you want to continue connecting (yes/no)? %s,%sFailed to add the host to the list of known hosts (%.500s).Warning: Permanently added '%.200s' (%s) to the list of known hosts.is unknownis unchangedhas a different value@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@ WARNING: POSSIBLE DNS SPOOFING DETECTED! @The %s host key for %s has changed,and the key for the according IP address %s%s. This could either mean thatDNS SPOOFING is happening or the IP address for the hostand its host key have changed at the same time.Offending key for IP in %s:%dAdd correct host key in %.100s to get rid of this message.NX> 209 Remote host identification has changed.Offending key in %s:%d%s host key for %.200s has changed and you have requested strict checking.Password authentication is disabled to avoid man-in-the-middle attacks.Keyboard-interactive authentication is disabled to avoid man-in-the-middle attacks.Challenge/response authentication is disabled to avoid man-in-the-middle attacks.Agent forwarding is disabled to avoid man-in-the-middle attacks.X11 forwarding is disabled to avoid man-in-the-middle attacks.Port forwarding is disabled to avoid man-in-the-middle attacks.internal errorWarning: the %s host key for '%.200s' differs from the key for the IP address '%.128s' Offending key for IP in %s:%d Matching host key in %s:%d%sExiting, you have requested strict checking. Are you sure you want to continue connecting (yes/no)? Update the SSHFP RR in DNS with the new host key to get rid of this message.NX> 202 Authenticating user: %.200sWARNING: %s key found for host %s in %s:%d %s key fingerprint %s.no key of type %d for host %s@ WARNING: REMOTE HOST IDENTIFICATION HAS CHANGED! @IT IS POSSIBLE THAT SOMEONE IS DOING SOMETHING NASTY!Someone could be eavesdropping on you right now (man-in-the-middle attack)!It is also possible that the %s host key has just been changed.The fingerprint for the %s key sent by the remote host is %s.Please contact your system administrator.@(#)$OpenBSD: sshconnect1.c,v 1.60 2004/07/28 09:40:29 markus Exp $try_agent_authentication: BN_new failedTrying RSA authentication via agent with '%.100s'Server refused our key.Protocol error during RSA authentication: %dsshconnect1.cPacket integrity error (%d bytes remaining) at %s:%dPacket integrity error.Received RSA challenge from server.Authentication agent failed to decrypt challenge.Sending response to RSA challenge.RSA authentication accepted by server.Protocol error waiting RSA auth response: %dRSA authentication using agent refused.respond_to_rsa_challenge: rsa_private_decrypt failedrespond_to_rsa_challenge: bad challenge length %dSending response to host key RSA challenge.Trying RSA authentication with key '%.100s'try_rsa_authentication: BN_new failedEnter passphrase for RSA key '%.100s': no passphrase given, try next keybad passphrase given, try again...Bad passphrase.RSA authentication refused.Trying rhosts or /etc/hosts.equiv with RSA host authentication.Server refused our rhosts authentication or host key.try_rhosts_rsa_authentication: BN_new failedReceived RSA challenge for host key from server.Rhosts or /etc/hosts.equiv with RSA host authentication accepted by server.Rhosts or /etc/hosts.equiv with RSA host authentication refused.Doing challenge response authentication.Protocol error: got %d in response to SSH_CMSG_AUTH_TISNo challenge. Response: %s%sPermission denied, please try again.WARNING: Encryption is disabled! Response will be transmitted in clear text.Protocol error: got %d in response to SSH_CMSG_AUTH_TIS_RESPONSEDoing password authentication.WARNING: Encryption is disabled! Password will be transmitted in clear text.Protocol error: got %d in response to passwd authWaiting for server public key.Warning: Server lies about size of server public key: actual size is %d bits vs. announced %d.Warning: This may be due to an old implementation of ssh.Warning: Server lies about size of server host key: actual size is %d bits vs. announced %d.Received server public key (%d bits) and host key (%d bits).Host key verification failed.respond_to_rsa_challenge: BN_new failedrespond_to_rsa_challenge: host_key %d < server_key %d + SSH_KEY_BITS_RESERVED %drespond_to_rsa_challenge: server_key %d < host_key %d + SSH_KEY_BITS_RESERVED %dNo valid SSH1 cipher, using %.100s instead.Selected cipher type %.100s not supported by server.Encryption type: %.100sSent encrypted session key.Received encrypted confirmation.ssh_userauth1: server supports no auth methodsProtocol error: got %d in response to SSH_CMSG_USER%.30s@%.128s's password: Permission denied.@(#)$OpenBSD: sshconnect2.c,v 1.138 2004/06/13 12:53:24 djm Exp $none,zlibhmac-md5,hmac-sha1,hmac-ripemd160,hmac-ripemd160@openssh.com,hmac-sha1-96,hmac-md5-96aes128-cbc,3des-cbc,blowfish-cbc,cast128-cbc,arcfour,aes192-cbc,aes256-cbc,rijndael-cbc@lysator.liu.se,aes128-ctr,aes192-ctr,aes256-ctrssh-rsa,ssh-dssdiffie-hellman-group-exchange-sha1,diffie-hellman-group14-sha1,diffie-hellman-group1-sha1Host key verification failed.No valid ciphers for protocol version 2 given, using defaults.zlib,nonenonepasswordkeyboard-interactivepublickeyhostbasedssh-userauthSSH2_MSG_SERVICE_REQUEST sentServer denied authentication request: %dservice_accept: %sbuggy server: service_accept w/o servicesshconnect2.cPacket integrity error (%d bytes remaining) at %s:%dPacket integrity error.SSH2_MSG_SERVICE_ACCEPT receivedssh-connectionssh_userauth2: internal error: cannot send userauth none requestNX> 206 ssh-userauth2 successful: method %s Authentication succeeded (%s).NX> 204 Authentication failed. Permission denied (%s).we sent a %s packet, wait for replywe did not send a packet, disable methodinput_userauth_error: bad message during authentication: type %dinput_userauth_banner%sinput_userauth_success: no authentication contextinput_userauth_failure: no authentication contextAuthenticated with partial success.Authentications that can continue: %sinput_userauth_pk_ok: no authentication contextinput_userauth_pk_ok: SSH_BUG_PKOKServer accepts key: pkalg %s blen %uunknown pkalg %sno key from blob. pkalg %sinput_userauth_pk_ok: type mismatch for decoded key (received %d, expected %d)input_userauth_pk_ok: fp %sPermission denied, please try again.NX> 205 %.30s@%.128s's password: %.30s@%.128s's password: input_userauth_passwd_changereqinput_userauth_passwd_changereq: no authentication contextEnter %.30s@%.128s's old password: Enter %.30s@%.128s's new password: Retype %.30s@%.128s's new password: Mismatch; try again, EOF to quit.sign_and_send_pubkeysign_and_send_pubkey: cannot handle keyuserauth_pubkey: internal errorsend_pubkey_testsend_pubkey_test: cannot handle keyno such identity: %sNX> 210 Enter passphrase for key '%.100s': no passphrase given, try next keybad passphrase given, try again...key: %s (%p)Offering public key: %sTrying private key: %suserauth_kbdint: disable: no info_req_seenuserauth_kbdintinput_userauth_info_reqinput_userauth_info_req: no authentication contextinput_userauth_info_req: num_prompts %dNX> 205 ssh_keysign called/usr/local/libexec/ssh-keysignssh_keysign: no installed: %sssh_keysign: fflush: %sssh_keysign: pipe: %sssh_keysign: fork: %sssh_keysign: dup2: %sssh_keysign: exec(%s): %sssh_keysign: couldn't send requestssh_keysign: no replyssh_keysign: bad versionNo more client hostkeys for hostbased authentication.userauth_hostbased: cannot get local ipaddr/name.userauth_hostbased: chost %skey_sign failedNULLSkipping authentication method name: %sUnrecognized authentication method name: %sstart over, passed a different list %spreferred %sNo more authentication methods to try.authmethod_lookup %sremaining preferred: %sauthmethod_is_enabled %sNext authentication method: %sNX> 208 Using auth method: %s ,NX> 299 Switch connection to: NX> 280 Can't handle exception fds in selectNX> 285 Going to check input for fd: %dauthentication agent connectionNX> 285 Detected authentication agent connectionNX> 289 Discarding spurious data: '%s'NX> 290 End of input received before switch command NX> 288 Buffer length of: %d bytes exceededNX> 290 Don't use the -B option with binary dataNX> 280 Adding: %d bytes to the temporary bufferNX> 280 Dumping content of the temporary buffer:NX> 280 Switch command maybe found at position: %dNX> 280 Adding: %d bytes to the returned bufferNX> 280 Left: %d bytes in the temporary bufferNX> 280 Searching newline with: %d bytes remainingNX> 290 Can't find the terminating newline in buffer:NX> 280 Checking command with length: %dNX> 298 Out of memory checking the command stringNX> 280 Analyzing command string:NX> 280 Content of the temporary buffer: NX> 298 Parse error in the switch parametersNX> 285 Searching switch parameters in command:NX> 285 Identified host: %s port: %dNX> 285 Identified cookie: %sNX> 285 Identified descriptors in: %d out: %dNX> 285 Identified port: %d accept: %sNX> 285 Identified internal connectionencryptedunencrypteddefaultNX> 290 Not supported mode: %sNX> 285 Identified mode: %sNX> 285 Using default mode encryptedNX> 285 Identified options: %s%s%%128[^:]:%%5[0-9] in: %%5[0-9] out: %%5[0-9]NX> 280 Searching with matching string:%s SSH port: %%5[0-9] accept: %%128s%s SSH in: %%5[0-9] out: %%5[0-9]%s%%128[^:]:%%5[0-9] cookie: %%32s%s%%128[^:]:%%5[0-9]%s NX mode: %%16s options: %%1023s%s NX mode: %%16s%s NX options: %%1023s%s%%2sNX NX> 297 Missing data to perform the switchNX> 280 Shutting down the proxy fd: %dNX> 280 Waiting for the NX transport to terminateNX> 280 NX transport successfully terminatedNX> 280 Creating proxy with options: %sNX> 280 Creating proxy with null optionsNX> 290 Failure creating the socket pair: %sNX> 280 Using local end: %d remote end: %dNX> 290 Failed to create the internal connectionNX> 280 Proxy opened with local: %d remote: %dNX> 280 Should enable NX memory-to-memory agent transport NX> 291 Connecting to: %s:%d NX> 297 Can't resolve address of host: %s NX> 296 Can't create the connecting socket NX> 295 Can't set the SO_REUSEADDR on socketNX> 294 Connection to: %s:%d failed. RetryingNX> 290 Failed connection to: %s:%dNX> 294 Connected to proxy at: %s:%d2.0.0NXSSH-%s cookie=%s NX> 285 Sending authentication cookie: %sNX> 285 Client side loop completedNX> 285 Switching descriptors: %d and: %d to: %d NX> 292 Can't redirect I/O to channel descriptors NX> 287 Redirected I/O to channel descriptorsNX> 280 Proxy in: %d out: %d transport in: %d out: %dNX> 290 Can't switch communication to: %s:%dNX> 290 Can't switch communication to in: %d out: %dNX> 290 Can't duplicate descriptor: %d to: %d error: '%s'NX> 285 Duplicated descriptor: %d to: %d NX> 297 Cannot accept connections from unknown host: %s NX> 297 Can't create socket error: %s NX> 297 Can't bind to port: %i error: %s NX> 297 Can't listen on port: %i error: %sNX> 291 Waiting for remote connection on port: %d from: %s NX> 297 Call to select failed error: %s NX> 297 Call to accept failed error: %sNX> 297 Refused connection from: %s with port: %d NX> 297 Connection with remote host: %s could not be established NX> 297 Can't redirect port to channel descriptorsNX> 285 Entering the server side NX loop with proxy at: %s:%dNX> 280 Failed select on input descriptorsNX> 280 Exiting from the server side loopNX> 290 Failed read on proxy descriptorNX> 290 Failed write on proxy descriptorNX> 290 Failed read on channel descriptorNX> 290 Failed write on channel descriptorNX> 285 Entering the client side NX loopNX> 285 Exiting from the client side loop---NX> 298 Out of memory creating the temporary stringNX> 280 Lefthand remaining bytes are: %dNX> 280 Righthand remaining bytes are: %dNX> 280 Total remaining bytes are: %dNX> 286 Setting O_NONBLOCK on descriptor: %dNX> 286 Failed to set O_NONBLOCK on descriptor: %dNX> 286 Set O_NONBLOCK on descriptor: %dNX> 286 Resetting O_NONBLOCK on descriptor: %dNX> 286 Failed to reset O_NONBLOCK on descriptor: %dNX> 286 Reset O_NONBLOCK on descriptor: %dNX> 286 Trying TCP_NODELAY on descriptor: %dNX> 286 Failed to set TCP_NODELAY on descriptor: %dNX> 286 Option TCP_NODELAY not supported on: %dNX> 286 Set TCP_NODELAY on descriptor: %dNX> 286 Trying SO_KEEPALIVE on descriptor: %dNX> 286 Failed to set SO_KEEPALIVE on descriptor: %dNX> 286 Set SO_KEEPALIVE on descriptor: %dNX> 286 Trying IPTOS_LOWDELAY on descriptor: %dNX> 286 Failed to set IPTOS_LOWDELAY on descriptor: %dNX> 286 Option IPTOS_LOWDELAY not supported on: %dNX> 286 Set IPTOS_LOWDELAY on descriptor: %dNX> 285 Enabling redirection of debug outputNX> 280 Using proxy log file: %sNX> 280 Can't determine the name of the proxy logaNX> 280 Can't open log file: %s error is: %d, '%s'NX> 280 Can't redirect the log to file: %s@(#)$OpenBSD: authfd.c,v 1.64 2004/08/11 21:44:31 avsm Exp $SSH_AUTH_SOCKError writing to authentication socket.Error reading response length from authentication socket.Authentication response too long: %uError reading response from authentication socket.Bad authentication reply message type: %dToo many identities in authentication reply: %dWarning: identity keysize mismatch: actual %d, announced %uCompatibility with ssh protocol version 1.0 no longer supported.Agent admitted failure to authenticate using the key.Bad authentication response: %dAgent admitted failure to sign using the key.SSH_AGENT_FAILUREBad response from authentication agent: %d@`@(#)$OpenBSD: authfile.c,v 1.57 2004/06/21 17:36:31 avsm Exp $SSH PRIVATE KEY FILE FORMAT 1.1 save_private_key_rsa: bad cipheropen %s failed: %s.write to key file %s failed: %spassphrase too short: have %d bytes, need > 4wfdopen %s failed: %s.key_save_private: cannot save key type %dfstat for key file %.200s failed: %.100sRead from key file %.200s failed: %.100sNot a RSA1 key file %.200s.Unsupported cipher %d used in key file %.200s.Bad passphrase supplied for key file %.200s.key_load_private_rsa1: RSA_blinding_on failedrfdopen failed: %sPEM_read_PrivateKey failedrsa w/o commentkey_load_private_pem: RSA_blinding_on faileddsa w/o commentPEM_read_PrivateKey: mismatch or unknown EVP_PKEY save_type %dread PEM private key done: type %s@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@ WARNING: UNPROTECTED PRIVATE KEY FILE! @Permissions 0%3.3o for '%s' are too open.It is recommended that your private key files are NOT accessible by others.This private key will be ignored.bad permissions: ignore key: %s.pub @(#)$OpenBSD: bufaux.c,v 1.32 2004/02/23 15:12:46 markus Exp $buffer_put_bignum: BN_bn2bin() failed: oi %d != bin_size %dbuffer_get_bignum: cannot handle BN of size %dbuffer_get_bignum: input buffer too smallbuffer_put_bignum2: negative numbers not supportedbuffer_put_bignum2: BN too smallbuffer_put_bignum2: BN_bn2bin() failed: oi %d != bin_size %dbuffer_get_bignum2: negative numbers not supportedbuffer_get_bignum2: cannot handle BN of size %dbuffer_get_string: bad string length %ubuffer_put_cstring: s == NULL@(#)$OpenBSD: buffer.c,v 1.21 2003/11/21 11:57:03 djm Exp $buffer_append_space: len %u not supportedbuffer_append_space: alloc %u not supportedbuffer_get: trying to get more bytes %d than in buffer %dbuffer_consume: trying to get more bytes than in bufferbuffer_consume_end: trying to get more bytes than in buffer%02x @(#)$OpenBSD: canohost.c,v 1.41 2004/07/21 11:51:29 djm Exp $getpeername failed: %.100sget_remote_hostname: getnameinfo NI_NUMERICHOST failedTrying to reverse map address %.100s.0Nasty PTR record "%s" is set up for %s, ignoringreverse mapping checking getaddrinfo for %.700s failed - POSSIBLE BREAKIN ATTEMPT!Address %.100s maps to %.600s, but this does not map back to the address - POSSIBLE BREAKIN ATTEMPT!ip %2.2xConnection from %.100s with IP options:%.800sNormalising mapped IPv4 in IPv6 addressUNKNOWNget_socket_address: getnameinfo %d failedgetsockname failed: %.100sget_sock_port: getnameinfo NI_NUMERICSERV failed@(#)$OpenBSD: channels.c,v 1.209 2004/08/11 21:43:04 avsm Exp $channel_lookup: %d: bad idchannel_lookup: %d: bad id: channel freechannel %d: rfd %d isattychannel %d: wfd %d is not a tty?channel_new: internal error: channels_alloc %d too big.channel: expanding %dchannel %d: new [%s]channel %d: close_fds r %d w %d e %d c %d???channel %d: free: %s, nchannels %uchannel %d: status: %schannel %d: big output buffer %u > %ucannot happen: SSH_CHANNEL_LARVALcannot happen: OUT_DRAINchannel_still_open: bad channel type %dchannel_find_open: bad channel type %dThe following connections are open: #%d %.300s (t%d r%d i%d/%d o%d/%d fd %d/%d cfd %d) channel_open_message: bad channel type %dchannel_send_open: %d: bad idchannel %d: send openchannel_request_start: %d: unknown channel idchannel %d: request %s confirm %dchannel_register_comfirm: %d: bad idchannel_register_cleanup: %d: bad idchannel_cancel_cleanup: %d: bad idchannel_register_filter: %d: bad idchannel_activate for non-larval channel %d.channel %d: waiting for connectionchannel %d: obuf_empty delayed efd %d/(%d)channel %d: closing after input drain.Initial X11 packet contains bad byte order byte: 0x%xX11 connection uses different authentication protocol.X11 auth data does not match fake data.X11 fake_data_len %d != saved_data_len %dX11 connection rejected because of wrong authentication.X11 rejected %d i%d/o%dX11 closed %d i%d/o%dchannel %d: decode socks4channel %d: decode socks4: too longchannel %d: decode socks4: user %s/%dchannel %d: decode socks4: len %d > have %dchannel %d: dynamic request: socks4 host %s port %u command %uchannel %d: cannot handle: socks4 cn %dchannel %d: decode socks5channel %d: method SSH_SOCKS5_NOAUTH not foundchannel %d: socks5 auth donechannel %d: socks5 post authchannel %d: only socks5 connect supportedchannel %d: bad socks5 atyp %dchannel %d: dynamic request: socks5 host %s port %u command %uchannel %d: pre_dynamic: have %dchannel %d: pre_dynamic: need moredirect-tcpipX11 connection requested.single_connection: closing X11 listener.accept: %.100sX11 connection from %.200s port %daccepted x11 socketx11ssh2 x11 bug compat mode%s: listening port %d for %.100s port %d, connect from %.200s port %dConnection to port %d forwarding to %.100s port %d requested.forwarded-tcpipdynamic-tcpipaccept from auth socket: %.100saccepted auth socketauth-agent@openssh.comgetsockopt SO_ERROR failedchannel %d: connectedchannel %d: not connected: %schannel %d: read<=0 rfd %d len %dchannel %d: not openchannel %d: input draining.channel %d: filter stopschannel %d: written %d to efd %dchannel %d: closing write-efd %dchannel %d: read %d from efd %dchannel %d: closing read-efd %dchannel %d: ctl read<=0channel_handle_ctl%s: unexpected data on ctl fdchannel %d: window %d sent adjust %dNX> 290 Error while switching communicationchannel %d: gc: notify userchannel %d: gc: user detachedchannel %d: garbage collectingchannel %d: will not send data after closecannot happen: istate == INPUT_WAIT_DRAIN for proto 1.3channel %d: ibuf_empty delayed efd %d/(%d)channel %d: rwin %u elen %u euse %dchannel %d: sent ext data %dReceived data for nonexistent channel %d.channel %d: rcvd big packet %d, maxpack %dchannel %d: rcvd too much data %d, win %dchannels.cPacket integrity error (%d bytes remaining) at %s:%dPacket integrity error.Received extended_data for bad channel %d.channel %d: ext data for non openchannel %d: accepting ext data after eofReceived extended_data after EOF on channel %d.channel %d: bad ext datachannel %d: rcvd too much extended_data %d, win %dchannel %d: rcvd ext data %dReceived ieof for nonexistent channel %d.NX> 280 Ignoring EOF on the monitored channelchannel %d: FORCE input drainReceived close for nonexistent channel %d.Received oclose for nonexistent channel %d.NX> 280 Ignoring CLOSE on the monitored channelReceived close confirmation for out-of-range channel %d.Received close confirmation for non-closed channel %d (type %d).Received open confirmation for non-opening channel %d.callback startcallback donechannel %d: open confirm rwindow %u rmax %uadministratively prohibitedconnect failedunknown channel typeresource shortageunknown reasonReceived open failure for non-opening channel %d.: channel %d: open failed: %s%s%sReceived window adjust for non-open channel %d.channel %d: rcvd adjust %uunknown (remote did not supply name)connected socketNo forward host name.Forward host name too long.%dgetaddrinfo: fatal errorchannel_setup_fwd_listener: getnameinfo failedsocket: %.100ssetsockopt SO_REUSEADDR: %sLocal forwarding listening on %s port %s.bind: %.100slisten: %.100sport listenerchannel_setup_fwd_listener: cannot listen to port: %dchannel_cancel_rport_listener%s: close clannel %dchannel_request_remote_forwarding: too many forwards0.0.0.0tcpip-forwardWarning: Server denied remote port forwarding.Protocol error for port forward request:received packet type %d.channel_request_rforward_cancel%s: requested forward not foundcancel-tcpip-forwardRequested forwarding of port %d but user is not root.Dynamic forwarding denied.allow port forwarding to host %s port %dconnect_to %.100s: unknown host (%s)connect_to: getnameinfo failedconnect_to%s: set_nonblock(%d)connect_to %.100s port %s: %.100sconnect_to %.100s port %d: failed.WARNING: Server requests forwarding for unknown listen_port %dReceived request to connect to host %.100s port %d, but the request was denied.window-changegetaddrinfo: %.100sx11_create_display_inet: Socket family %d not supportedbind port %d: %.100sFailed to allocate internet-domain X11 display socket.X11 inet listenerx11 listener/tmp/.X11-unix/X%uconnect %.100s: %.100sDISPLAYDISPLAY not set.unix:Could not parse display number from DISPLAY: %.100sCould not find ':' in DISPLAY: %.100s%.100s: unknown host. (%s)connect %.100s port %d: %.100sReceived X11 open request.connected x11 socketWarning: ssh server tried agent forwarding.Warning: ssh server tried X11 forwarding.deny_input_open: type %dWarning: this is probably a break in attempt by a malicious server.%2xx11_request_forwarding: bad authentication data: %.100s%02xx11-req@@@@@@@@@@@@@@@A@A@A&A@A&A&AAA&A@A@A@A@A@(#)$OpenBSD: cipher.c,v 1.71 2004/07/28 09:40:29 markus Exp $acss@openssh.orgaes256-ctraes192-ctraes128-ctrrijndael-cbc@lysator.liu.seaes256-cbcaes192-cbcaes128-cbcarcfourcast128-cbcblowfish-cbc3des-cbcblowfish3desdesnone,bad cipher %s [%s]cipher ok: %s [%s]ciphers ok: [%s]Warning: use of DES is strongly discouraged due to cryptographic weaknessescipher_init: key length %d is insufficient for %s.cipher_init: iv length %d is insufficient for %s.cipher_init: EVP_CipherInit failed for %scipher_init: set keylen (%d -> %d)cipher_init: set keylen failed (%d -> %d)cipher_init: EVP_CipherInit: set key failed for %scipher_encrypt: bad plaintext length %devp_crypt: EVP_Cipher failedcipher_cleanup: EVP_CIPHER_CTX_cleanup failedcipher_get_keyiv%s: wrong iv length %d != %d%s: bad cipher %dcipher_set_keyiv@(#)$Id: cipher-acss.c,v 1.2 2004/02/06 04:26:11 dtucker Exp $ @@(#)$OpenBSD: cipher-bf1.c,v 1.1 2003/05/15 03:08:29 markus Exp $@(#)$OpenBSD: cipher-ctr.c,v 1.4 2004/02/06 23:41:13 dtucker Exp $ssh_aes_ctr_iv: no context @@(#)$OpenBSD: cipher-3des1.c,v 1.2 2003/12/22 20:29:55 markus Exp $ssh1_3des_cbc: no contextssh1_3des_iv%s: bad 3des iv length: %d%s: no 3des context%s: Installed 3DES IV%s: Copying 3DES IV @@(#)$OpenBSD: compat.c,v 1.70 2003/11/02 11:01:03 markus Exp $Enabling compatibility mode for protocol 2.0Enabling compatibility mode for protocol 1.3Probe-**SSH_Version_Mapper**OSU_0*,OSU_1.0*,OSU_1.1*,OSU_1.2*,OSU_1.3*,OSU_1.4*,OSU_1.5alpha1*,OSU_1.5alpha2*,OSU_1.5alpha3**SSH Compatible Server*1.3.2*1.2.18*,1.2.19*,1.2.20*,1.2.21*,1.2.22*1.7 SecureFX*3.0 SecureCRT*3.0.*2.*2.42.3.*2.2.0*,2.3.0*2.0.*2.0.11*,2.0.12*2.0.13*,2.0.14*,2.0.15*,2.0.16*,2.0.17*,2.0.18*,2.0.19*2.1 *2.1.0**MindTerm*OpenSSH*Sun_SSH_1.0*OpenSSH_2.*,OpenSSH_3.0*,OpenSSH_3.1*OpenSSH_2.5.3*OpenSSH_2.5.0*,OpenSSH_2.5.1*,OpenSSH_2.5.2*OpenSSH_2.5.0p1*,OpenSSH_2.5.1p1*OpenSSH_2.3.*OpenSSH_2.3.0*OpenSSH-2.0*,OpenSSH-2.1*,OpenSSH_2.1*,OpenSSH_2.2*match: %s pat %sno match: %s,ignoring bad proto spec: '%s'.aesOriginal cipher proposal: %sCompat cipher proposal: %sNo available ciphers found.`@(#)$OpenBSD: fatal.c,v 1.2 2003/09/23 20:17:11 markus Exp $@(#)$OpenBSD: hostfile.c,v 1.32 2003/11/10 16:23:41 jakob Exp $Warning: %s, line %d: keysize mismatch for host %s: actual %d vs. announced %d.Warning: replace %d with %d in %s, line %d.check_host_in_hostfile: filename %srcheck_host_in_hostfile: match line %dno key to look upa%s add_host_to_hostfile: saving key in %s failed @(#)$OpenBSD: log.c,v 1.29 2003/09/23 20:17:11 markus Exp $LOCAL7LOCAL6LOCAL5LOCAL4LOCAL3LOCAL2LOCAL1LOCAL0AUTHPRIVAUTHUSERDAEMONDEBUG3DEBUG2DEBUG1DEBUGVERBOSEINFOERRORFATALQUIETUnrecognized internal syslog level code %d Unrecognized internal syslog facility code %d fatalerrordebug1debug2debug3internal error%s: %s%s %.500s8cPc`c`cgcscc e0e@ePe`epeeeeeee@(#)$OpenBSD: match.c,v 1.19 2002/03/01 13:12:10 markus Exp $,@(#)$OpenBSD: nchan.c,v 1.51 2004/07/11 17:48:47 deraadt Exp $closedwait_ieofdrainopenwait_oclosechan_set_istate: bad state %d -> %dchannel %d: input %s -> %schan_set_ostate: bad state %d -> %dchannel %d: output %s -> %schannel %d: rcvd oclosechannel %d: protocol error: rcvd_oclose for istate %dchannel %d: read failedchannel %d: chan_read_failed for istate %dchannel %d: ibuf emptychannel %d: chan_ibuf_empty for non empty bufferchannel %d: chan_ibuf_empty for istate %dchannel %d: rcvd ieofchannel %d: protocol error: rcvd_ieof for ostate %dchannel %d: write failedchannel %d: chan_write_failed for ostate %dchannel %d: obuf emptychannel %d: chan_obuf_empty for non empty bufferchannel %d: internal error: obuf_empty for ostate %dchannel %d: send ieofchannel %d: cannot send ieof for istate %dchannel %d: send oclosechannel %d: cannot send oclose for ostate %dchannel %d: rcvd closechannel %d: protocol error: close rcvd twicechannel %d: rcvd eofchannel %d: send eofchannel %d: cannot send eof for istate %dchannel %d: send closechannel %d: cannot send close for istate/ostate %d/%dchannel %d: already sent closechannel %d: zombiechannel %d: is deadchannel %d: active efd: %d len %dchannel %d: almost deadchannel %d: close_writechannel %d: chan_shutdown_write: shutdown() failed for fd%d: %.100schannel %d: chan_shutdown_write: close() failed for fd%d: %.100schannel %d: close_readchannel %d: chan_shutdown_read: shutdown() failed for fd%d [i%d o%d]: %.100schannel %d: chan_shutdown_read: close() failed for fd%d: %.100s@(#)$OpenBSD: packet.c,v 1.115 2004/06/21 17:36:31 avsm Exp $nonepacket_set_connection: cannot load cipher 'none'Compression already enabled.packet_set_encryption_key: unknown cipher number %dpacket_set_encryption_key: keylen too small: %dpacket_set_encryption_key: keylen too big: %dset_newkeys: mode %dset_newkeys: rekeyingnewkeys: no keys for mode %dpacket_send2: adding %d (len %d padlen %d extra_pad %d)outgoing seqnr wraps aroundXXX too many packets with same keyenqueue packet: %udequeue packet: %upacket.cPacket integrity error (%d bytes remaining) at %s:%dPacket integrity error.Connection closed by %.200sRead from socket failed: %.100sProtocol error: expected packet type %d, got %dBad packet length %u.crc32 compensation attack: network attack detectedpacket_read_poll1: len %d != buffer_len %d.Corrupted check bytes on input.padding error: need %d block %d mod %dCorrupted MAC on input.incoming seqnr wraps aroundCorrupted padlen %d on input.Remote: %.900sReceived disconnect from %s: %u: %.400sReceived SSH2_MSG_UNIMPLEMENTED for %uReceived disconnect from %s: %.400spacket_disconnect called recursively.Disconnecting: %.100sWrite failed: %.100sIPTOS_LOWDELAYIPTOS_THROUGHPUTNX> 286 Setting %s on fd: %dsetsockopt IP_TOS %d: %.100s:NX> 286 Called packet_set_interactive() for fd: %d interactive is: %dNX> 286 Forcing interactive to: %d for fd: %dpacket_set_maxsize: called twice: old %d new %dpacket_set_maxsize: bad size %dpacket_set_maxsize: setting to %d`@(#)$OpenBSD: readpass.c,v 1.30 2004/06/17 15:10:14 djm Exp $ssh_askpass: fflush: %sinternal error: askpass undefinedssh_askpass: pipe: %sssh_askpass: fork: %sssh_askpass: dup2: %sssh_askpass: exec(%s): %s /dev/ttyDISPLAYSSH_ASKPASS/usr/local/libexec/ssh-askpass @(#)$OpenBSD: rsa.c,v 1.24 2001/12/27 18:22:16 markus Exp $rsa_public_encrypt() exponent too small or not oddrsa_public_encrypt() failedrsa_private_decrypt() failedrsa_generate_additional_parameters: BN_new failedrsa_generate_additional_parameters: BN_CTX_new failed @@(#)$OpenBSD: tildexpand.c,v 1.15 2004/05/21 08:43:03 markus Exp $User name after tilde too long.Unknown user %100s.Home directory too long (%d > %d/%s%s%s @@(#)$OpenBSD: ttymodes.c,v 1.19 2003/04/08 20:21:29 itojun Exp $tty_make_modes: ospeed %dtty_make_modes: ispeed %dtty_make_modes: %d %dtty_parse_modes: SSH2 n_bytes %dtty_parse_modes: ispeed %dcfsetispeed failed for %dtty_parse_modes: ospeed %dcfsetospeed failed for %dtty_parse_modes: %d %dIgnoring unsupported tty mode opcode %d (0x%x)parse_tty_modes: unknown opcode %dparse_tty_modes: n_bytes_ptr != n_bytes: %d %dSetting tty modes failed: %.100sX @` @` @` @` @` @```  @(#)$OpenBSD: xmalloc.c,v 1.16 2001/07/23 18:21:46 stevesk Exp $xmalloc: zero sizexmalloc: out of memory (allocating %lu bytes)xrealloc: zero sizexrealloc: out of memory (new_size %lu bytes)xfree: NULL pointer given as argument" "@(#)$OpenBSD: atomicio.c,v 1.12 2003/07/31 15:50:16 avsm Exp $`""@(#)$OpenBSD: key.c,v 1.56 2004/07/28 09:40:29 markus Exp $key_new: RSA_new failedkey_new: BN_new failedkey_new: DSA_new failedkey_new: bad key type %dkey_new_private: BN_new failedkey_free: bad key type %dkey_equal: bad key type %dkey_fingerprint_raw: bad digest type %dkey_fingerprint_raw: bad key type %dkey_fingerprint_raw: blob is null%02x:bcdfghklmnprstvzxkey_fingerprint: null from key_fingerprint_raw()key_fingerprint_ex: bad digest representation %dwrite_bignum: BN_bn2dec() failed %skey_read: missing whitespacekey_read: missing keytypekey_read: short stringkey_read: type mismatchkey_read: uudecode %s failedkey_read: key_from_blob %s failedkey_read: type mismatch: encoding errorkey_read: bad key type: %d%ukey_write: failed for RSA key%s %sRSA1RSADSAunknownssh-rsassh-dssssh-unknownrsa_generate_private_key: key generation failed.dsa_generate_private_key: DSA_generate_parameters faileddsa_generate_private_key: DSA_generate_key failed.dsa_generate_private_key: NULL.key_generate: unknown type %dkey_from_private: unknown type %drsa1rsadsakey_type_from_name: unknown key type '%s',key names ok: [%s]key_from_blob: cannot handle type %skey_from_blob: remaining bytes in key blob %dkey_to_blob: key == NULLkey_to_blob: unsupported key type %dkey_sign: invalid key type %dkey_verify: invalid key type %dkey_demote: RSA_new failedkey_demote: BN_dup failedkey_demote: DSA_new failed`))@(#)$OpenBSD: dispatch.c,v 1.16 2003/04/08 20:21:28 itojun Exp $dispatch_protocol_error: type %d seq %uprotocol errordispatch_protocol_ignore: type %d seq %uprotocol error: rcvd type %d**@(#)$OpenBSD: kex.c,v 1.60 2004/06/21 17:36:31 avsm Exp $kex_parse_kexinit: %skex_parse_kexinit: first_kex_follows %d kex_parse_kexinit: reserved %d Hm, kex protocol error: type %d seq %uSSH2_MSG_NEWKEYS sentexpecting SSH2_MSG_NEWKEYSkex.cPacket integrity error (%d bytes remaining) at %s:%dPacket integrity error.SSH2_MSG_NEWKEYS receivedkex_send_kexinit: no kex, cannot rekeyKEX_INIT_SENTkex_send_kexinit: kex proposal too shortSSH2_MSG_KEXINIT sentSSH2_MSG_KEXINIT receivedkex_input_kexinit: no kex, cannot rekeyUnsupported key exchange %dno matching cipher found: client %s server %smatching cipher is not supported: %sno matching mac found: client %s server %sunsupported mac %sno matching comp found: client %s server %szlibnoneunsupported comp %sno kex algdiffie-hellman-group1-sha1diffie-hellman-group14-sha1diffie-hellman-group-exchange-sha1bad kex alg %sno hostkey algbad hostkey alg '%s'proposal mismatch: my %s peer %sproposals matchclient->serverserver->clientkex: %s %s %s %sskipping next packet (type %u)kex_derive_keysderive_ssh1_session_id%s: bad host modulus (len %d)%s: bad server modulus (len %d)0 0@(#)$OpenBSD: mac.c,v 1.6 2003/09/18 13:02:21 miod Exp $hmac-ripemd160@openssh.comhmac-ripemd160hmac-md5-96hmac-md5hmac-sha1-96hmac-sha1mac_init: found %smac_init: unknown %smac_compute: no keymac_compute: mac too long,bad mac %s [%s]mac ok: %s [%s]macs ok: [%s]@1`1@(#)$OpenBSD: uidswap.c,v 1.24 2003/05/29 16:58:45 deraadt Exp $temporarily_use_uid: %u/%u (e=%u/%u)getgroups: %.100sinitgroups: %s: %.100ssetgroups: %.100ssetegid %u: %.100sseteuid %u: %.100srestore_uid: (unprivileged)restore_uid: temporarily_use_uid not effectiverestore_uid: %u/%upermanently_set_uid: temporarily_use_uid effectivepermanently_set_uid: %u/%usetresgid %u: %.100ssetresuid %u: %.100spermanently_set_uid%s: was able to restore old [e]gid%s: egid incorrect gid:%u egid:%u (should be %u)%s: was able to restore old [e]uid%s: euid incorrect uid:%u euid:%u (should be %u)44@(#)$OpenBSD: uuencode.c,v 1.17 2003/11/10 16:23:41 jakob Exp $%c 5 5@(#)$OpenBSD: misc.c,v 1.25 2004/08/11 21:43:05 avsm Exp $fcntl(%d, F_GETFL, 0): %sfd %d is O_NONBLOCKfd %d setting O_NONBLOCKfcntl(%d, F_SETFL, O_NONBLOCK): %sfd %d is not O_NONBLOCKfd %d clearing O_NONBLOCKfcntl(%d, F_SETFL, ~O_NONBLOCK): %sgetsockopt TCP_NODELAY: %.100sNX> 286 SSH reports TCP_NODELAY already set on descriptor: %dfd %d is TCP_NODELAYfd %d setting TCP_NODELAYNX> 286 SSH is setting TCP_NODELAY on descriptor: %dsetsockopt TCP_NODELAY: %.100s = 77@(#)$OpenBSD: monitor_fdpass.c,v 1.6 2004/08/13 02:51:48 djm Exp $mm_send_fd%s: sendmsg(%d): %s%s: sendmsg: expected sent 1 got %ldmm_receive_fd%s: recvmsg: %s%s: recvmsg: expected received 1 got %ld%s: no message header%s: expected type %d got %d89@(#)$OpenBSD: ssh-dss.c,v 1.19 2003/11/10 16:23:41 jakob Exp $ssh_dss_sign: no DSA keyssh_dss_sign: sign failedbad sig size %u %ussh-dssssh_dss_verify: no DSA keyssh_dss_verify: cannot handle type %sssh_dss_verify: remaining bytes in signature %dbad sigbloblen %u != SIGBLOB_LENssh_dss_verify: DSA_SIG_new failedssh_dss_verify: BN_new failedincorrecterrorcorrectssh_dss_verify: signature %s; ;@(#)$OpenBSD: ssh-rsa.c,v 1.31 2003/11/10 16:23:41 jakob Exp $ssh_rsa_sign: no RSA keyssh_rsa_sign: EVP_get_digestbynid %d failedssh_rsa_sign: RSA_sign failed: %sslen %u > len %ussh_rsa_sign: slen %u slen2 %ussh-rsassh_rsa_verify: no RSA keyssh_rsa_verify: RSA modulus too small: %d < minimum %d bitsssh_rsa_verify: cannot handle type %sssh_rsa_verify: remaining bytes in signature %dssh_rsa_verify: len %u > modlen %ussh_rsa_verify: add padding: modlen %u > len %ussh_rsa_verify: EVP_get_digestbynid %d failedinssh_rsa_verify: signature %scorrect0!0 +0 0 *H bad hashlenbad siglenRSA_public_decrypt failed: %sbad decrypted len: %d != %d + %doid mismatchhash mismatch>>@(#)$OpenBSD: kexdhc.c,v 1.2 2004/06/13 12:53:24 djm Exp $kexdh_client%s: Unexpected KEX type %dsending SSH2_MSG_KEXDH_INITexpecting SSH2_MSG_KEXDH_REPLYcannot decode server_host_key_blobtype mismatch for decoded server_host_key_blobcannot verify server_host_keyserver_host_key verification faileddh_server_pub == NULLkexdhc.cPacket integrity error (%d bytes remaining) at %s:%dPacket integrity error.bad server public DH valuekexdh_client: BN_new failedkey_verify failed for server_host_key@A`A@(#)$OpenBSD: kexgexc.c,v 1.2 2003/12/08 11:00:47 markus Exp $SSH2_MSG_KEX_DH_GEX_REQUEST_OLD(%u) sentSSH2_MSG_KEX_DH_GEX_REQUEST(%u<%u<%u) sentexpecting SSH2_MSG_KEX_DH_GEX_GROUPBN_newkexgexc.cPacket integrity error (%d bytes remaining) at %s:%dPacket integrity error.DH_GEX group out of range: %d !< %d !< %dSSH2_MSG_KEX_DH_GEX_INIT sentexpecting SSH2_MSG_KEX_DH_GEX_REPLYcannot decode server_host_key_blobtype mismatch for decoded server_host_key_blobcannot verify server_host_keyserver_host_key verification faileddh_server_pub == NULLbad server public DH valuekexgex_client: BN_new failedkey_verify failed for server_host_keyDD@(#)$OpenBSD: msg.c,v 1.7 2003/11/17 09:45:39 djm Exp $ssh_msg_send: type %ussh_msg_send: writessh_msg_recv enteringssh_msg_recv: read: header %ldssh_msg_recv: read: bad msg_len %ussh_msg_recv: read: %ld != msg_lenF F@(#)$OpenBSD: dns.c,v 1.10 2004/06/21 17:36:31 avsm Exp $data does not existname does not existinvalid parametergeneral failureout of memorysuccessunknown errorverify_hostkey_dnsNo key to look up!DNS lookup error: %sfound %d secure fingerprints in DNSfound %d insecure fingerprints in DNSError calculating host key fingerprint.Error parsing fingerprint from DNS.matching host key fingerprint found in DNSmismatching host key fingerprint found in DNSno host key fingerprint found in DNS      %s IN TYPE%d \# %d %02x %02x %s IN SSHFP %d %d %02x dns_export_rr: unsupported algorithm`II@(#)$Id: entropy.c,v 1.48 2003/11/21 12:56:47 djm Exp $PRNG is not seededOpenSSL version mismatch. Built against %lx, you have %lx J@J@(#)$OpenBSD: compress.c,v 1.21 2004/01/13 19:45:15 markus Exp $Enabling compression at level %d.Bad compression level %d.1.2.3compress outgoing: raw data %llu, compressed %llu, factor %.2fcompress incoming: raw data %llu, compressed %llu, factor %.2fbuffer_compress: deflate returned %dbuffer_uncompress: inflate returned %d0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ﾎCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-P P@(#)$OpenBSD: deattack.c,v 1.19 2003/09/18 08:49:45 markus Exp $detect_attack: bad length %dInstalling crc compensation attack detector.PP@(#)$OpenBSD: dh.c,v 1.31 2004/08/04 10:37:52 djm Exp $ parse_prime: BN_new failedBad prime description in line %dr/usr/local/etc/moduli/usr/local/etc/primesWARNING: %s does not exist, using fixed modulusWARNING: no suitable primes in %sWARNING: line %d disappeared in %s, giving upinvalid public DH value: negativbits set: %d/%dinvalid public DH value (%d/%d)dh_gen_key: dh->p == NULLdh_gen_key: group too small: %d (2*need %d)dh_gen_key: BN_new faileddh_gen_key: BN_rand failedDH_generate_keydh_gen_key: priv key bits set: %d/%ddh_gen_key: too many bad keys: giving updh_new_group_asc: DH_newBN_hex2bn pBN_hex2bn gdh_new_group: DH_new2FFFFFFFFFFFFFFFFC90FDAA22168C234C4C6628B80DC1CD129024E088A67CC74020BBEA63B139B22514A08798E3404DDEF9519B3CD3A431B302B0A6DF25F14374FE1356D6D51C245E485B576625E7EC6F44C42E9A637ED6B0BFF5CB6F406B7EDEE386BFB5A899FA5AE9F24117C4B1FE649286651ECE65381FFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFC90FDAA22168C234C4C6628B80DC1CD129024E088A67CC74020BBEA63B139B22514A08798E3404DDEF9519B3CD3A431B302B0A6DF25F14374FE1356D6D51C245E485B576625E7EC6F44C42E9A637ED6B0BFF5CB6F406B7EDEE386BFB5A899FA5AE9F24117C4B1FE649286651ECE45B3DC2007CB8A163BF0598DA48361C55D39A69163FA8FD24CF5F83655D23DCA3AD961C62F356208552BB9ED529077096966D670C354E4ABC9804F1746C08CA18217C32905E462E36CE3BE39E772C180E86039B2783A2EC07A28FB5C55DF06F4C52C9DE2BCBF6955817183995497CEA956AE515D2261898FA051015728E5A8AACAA68FFFFFFFFFFFFFFFF`WW@(#)$OpenBSD: kexdh.c,v 1.19 2003/02/16 17:09:57 markus Exp $WW@(#)$OpenBSD: kexgex.c,v 1.23 2003/02/16 17:09:57 markus Exp $ X@X@(#)$Id: bsd-arc4random.c,v 1.9 2004/07/18 23:30:40 djm Exp $Couldn't obtain random bytes (error %ld)XX@(#)$Id: bsd-getpeereid.c,v 1.3 2004/02/17 05:49:55 djm Exp $ Y@Y@(#)$Id: bsd-misc.c,v 1.25 2004/08/15 08:41:00 djm Exp $ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/=%s: illegal option -- %c %s: option requires an argument -- %c /dev/tty ?0?0?0?0?0?0?>>>>>>>0?0?0?0?0?0?0?0?0?0?0?0?0?0?0?0?0?0??R[G[5['[[[ Z@ZZ(Z)ZZ'pZ'XZ@Z- ZYYYAYAYAYA|YAnY@gY@ZY LY =Y<4Y 'Y*YY Y Y"Y$X#X XXXXXXX%vX&cXYXMX7X,X"XXXWWWW!W+W,W.W/wWAcW1RW3AW5 W2 W4V6V7V:V;V=V>V?   ܐd `xxX|t `xxX|tJܺX |T|v̺nLcX̵M 1 &UU UR p b @     ~U xU @_"-"'"D @  @@ @ '"    b\VQIC<5.VPF?VP[?0,0,`00`t0Y0FFFFnFZF3s;&c#kv>~6+n.f{ӓCKޞ NFW_LJZRʊٙI AؘH@=}5$m-et<|4%l,duݝM EܜL DYQɉXPȈחGOښJ BS[Ã^VΎ7w?"g'or:z2/j*b]U͍\Ť9y1 i)ap8x0!h(`q3;sS[u=5}]U{go'χ!ia)/CK ME JB H@>6~^Vt<4|\Tvjb*Š h`("NFLD GOIA ck#˃%me-ō+7?wW_q91yYQۓ՝ҚИnf.Ǝ$ld,Č&:2zZRp80xXPr֞Ԝߗљ@ `P0pH(hX8xD$dT4t L,l\<|B"bR2r J*jZ:zF&fV6vN.n^>~A!aQ1q I)iY9yE%eU5u M-m]=}C#cS3s K+k[;{G'gW7wO/o_?T TT@UY`Vc İ B(x $ܨHolooN}"2BRbr±ұ"2BRbr²Ҳ"2BRbr³ҳ"2BRbr´Ҵ"2BRbrµҵ"2BRbr¶Ҷ"2BRbr·ҷ"2BRbr¸Ҹ"2BRbr¹ҹ"2BRbrºҺ"2BRbr»һ"2BRbr¼Ҽ"2BRbr½ҽ"2BRbr¾Ҿ"2BRbr¿ҿ"2GCC: (GNU) 2.95.4 20011002 (Debian prerelease)GCC: (GNU) 2.95.4 20011002 (Debian prerelease)GCC: (GNU) 2.95.4 20011002 (Debian prerelease)GCC: (GNU) 2.95.4 20011002 (Debian prerelease)GCC: (GNU) 2.95.4 20011002 (Debian prerelease)GCC: (GNU) 2.95.4 20011002 (Debian prerelease)GCC: (GNU) 2.95.4 20011002 (Debian prerelease)GCC: (GNU) 2.95.4 20011002 (Debian prerelease)GCC: (GNU) 2.95.4 20011002 (Debian prerelease)GCC: (GNU) 2.95.4 20011002 (Debian prerelease)GCC: (GNU) 2.95.4 20011002 (Debian prerelease)GCC: (GNU) 2.95.4 20011002 (Debian prerelease)GCC: (GNU) 2.95.4 20011002 (Debian prerelease)GCC: (GNU) 2.95.4 20011002 (Debian prerelease)GCC: (GNU) 2.95.4 20011002 (Debian prerelease)GCC: (GNU) 2.95.4 20011002 (Debian prerelease)GCC: (GNU) 2.95.4 20011002 (Debian prerelease)GCC: (GNU) 2.95.4 20011002 (Debian prerelease)GCC: (GNU) 2.95.4 20011002 (Debian prerelease)GCC: (GNU) 2.95.4 20011002 (Debian prerelease)GCC: (GNU) 2.95.4 20011002 (Debian prerelease)GCC: (GNU) 2.95.4 20011002 (Debian prerelease)GCC: (GNU) 2.95.4 20011002 (Debian prerelease)GCC: (GNU) 2.95.4 20011002 (Debian prerelease)GCC: (GNU) 2.95.4 20011002 (Debian prerelease)GCC: (GNU) 2.95.4 20011002 (Debian prerelease)GCC: (GNU) 2.95.4 20011002 (Debian prerelease)GCC: (GNU) 2.95.4 20011002 (Debian prerelease)GCC: (GNU) 2.95.4 20011002 (Debian prerelease)GCC: (GNU) 2.95.4 20011002 (Debian prerelease)GCC: (GNU) 2.95.4 20011002 (Debian prerelease)GCC: (GNU) 2.95.4 20011002 (Debian prerelease)GCC: (GNU) 2.95.4 20011002 (Debian prerelease)GCC: (GNU) 2.95.4 20011002 (Debian prerelease)GCC: (GNU) 2.95.4 20011002 (Debian prerelease)GCC: (GNU) 2.95.4 20011002 (Debian prerelease)GCC: (GNU) 2.95.4 20011002 (Debian prerelease)GCC: (GNU) 2.95.4 20011002 (Debian prerelease)GCC: (GNU) 2.95.4 20011002 (Debian prerelease)GCC: (GNU) 2.95.4 20011002 (Debian prerelease)GCC: (GNU) 2.95.4 20011002 (Debian prerelease)GCC: (GNU) 2.95.4 20011002 (Debian prerelease)GCC: (GNU) 2.95.4 20011002 (Debian prerelease)GCC: (GNU) 2.95.4 20011002 (Debian prerelease)GCC: (GNU) 2.95.4 20011002 (Debian prerelease)GCC: (GNU) 2.95.4 20011002 (Debian prerelease)GCC: (GNU) 2.95.4 20011002 (Debian prerelease)GCC: (GNU) 2.95.4 20011002 (Debian prerelease)GCC: (GNU) 2.95.4 20011002 (Debian prerelease)GCC: (GNU) 2.95.4 20011002 (Debian prerelease)GCC: (GNU) 2.95.4 20011002 (Debian prerelease)GCC: (GNU) 2.95.4 20011002 (Debian prerelease)GCC: (GNU) 2.95.4 20011002 (Debian prerelease)GCC: (GNU) 2.95.4 20011002 (Debian prerelease)GCC: (GNU) 2.95.4 20011002 (Debian prerelease)GCC: (GNU) 2.95.4 20011002 (Debian prerelease)GCC: (GNU) 2.95.4 20011002 (Debian prerelease)GCC: (GNU) 2.95.4 20011002 (Debian prerelease)GCC: (GNU) 2.95.4 20011002 (Debian prerelease)GCC: (GNU) 2.95.4 20011002 (Debian prerelease)GCC: (GNU) 2.95.4 20011002 (Debian prerelease)GCC: (GNU) 2.95.4 20011002 (Debian prerelease)GCC: (GNU) 2.95.4 20011002 (Debian prerelease)GCC: (GNU) 2.95.4 20011002 (Debian prerelease)GCC: (GNU) 2.95.4 20011002 (Debian prerelease)GCC: (GNU) 2.95.4 20011002 (Debian prerelease)GCC: (GNU) 2.95.4 20011002 (Debian prerelease)GCC: (GNU) 2.95.4 20011002 (Debian prerelease)GCC: (GNU) 2.95.4 20011002 (Debian prerelease)GCC: (GNU) 2.95.4 20011002 (Debian prerelease)01.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.01.shstrtab.interp.note.ABI-tag.hash.dynsym.dynstr.gnu.version.gnu.version_r.rel.dyn.rel.plt.init.text.fini.rodata.data.eh_frame.dynamic.ctors.dtors.got.bss.comment.note  !((`'  /xx 7oNN&Doll(pS ܨ(H\ $$) eİ0%`0Pk@@@qBw B  j }} D,   x